CAZyme Information: MGYG000003525_00927

Basic Information

• Species: RC9 sp004556005
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; UBA932; RC9; RC9 sp004556005
• CAZyme ID: MGYG000003525_00927
• CAZy Family: GH23
• CAZyme Description: Membrane-bound lytic murein transglycosylase F

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
352		40072.73	7.5348

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003525	2213098	MAG	Fiji	Oceania

• Gene Location: Start: 19030; End: 20088 Strand: +

Full Sequence      

MDAGKQGLITVIVSSVLAVASFVAYWFQKSEPVVSRLDAGPVRCLIELKNYNDTSAVLIT
GFNYHLLKEFALDRDIDVTISLSDKFQSGLDSLKHGNVDILVLPFNDSKGLDSVLVSHPV
DSQTVWVFRGDWKHELSEVNHWIRQVHRRDNFNRTRASFMKVYSPFRSRPREMLSPYDSL
IRQYADSIGWDWRMMAAVIYQESHFHIEAQSHRGARGLMQMMPSTADTFGAGDLLDPEES
IRAGAKYLEKLSYRYNRLAANRLERDKFVLAAYNAGGGRIRDCIIFARSMGIEPKEWNDI
VSIIPHMQDSSTVAAVPEVKLGTFKGVETINYVNRVLALYNEFCRIAPKERE

Enzyme Prediction     

No EC number prediction in MGYG000003525_00927.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	190	343	6.7e-28	0.8148148148148148

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd13403	MLTF-like	2.72e-62	181	345	1	161	membrane-bound lytic murein transglycosylase F (MLTF) and similar proteins. This subfamily includes membrane-bound lytic murein transglycosylase F (MltF, murein lyase F) that degrades murein glycan strands. It is responsible for catalyzing the release of 1,6-anhydromuropeptides from peptidoglycan. Lytic transglycosylase catalyzes the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc) as do goose-type lysozymes. However, in addition, it also makes a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
COG4623	MltF	1.24e-33	165	336	259	424	Membrane-bound lytic murein transglycosylase MltF [Cell wall/membrane/envelope biogenesis, Signal transduction mechanisms].
PRK10859	PRK10859	1.47e-33	166	341	279	448	membrane-bound lytic murein transglycosylase MltF.
cd16896	LT_Slt70-like	2.24e-31	176	341	3	145	uncharacterized lytic transglycosylase subfamily with similarity to Slt70. Uncharacterized lytic transglycosylase (LT) with a conserved sequence pattern suggesting similarity to the Slt70, a 70kda soluble lytic transglycosylase which also has an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd00254	LT-like	3.91e-29	193	341	2	111	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CRY96252.1	4.37e-55	29	291	33	293
AGY53417.1	1.53e-44	60	343	59	347
QUB48180.1	2.13e-41	61	348	76	369
VEH15587.1	3.40e-41	61	343	106	394
AHM60830.1	9.94e-40	77	350	215	505

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4OZ9_A	6.05e-25	77	341	164	419	Crystalstructure of MltF from Pseudomonas aeruginosa complexed with isoleucine [Pseudomonas aeruginosa PAO1]
4OWD_A	6.46e-25	77	341	171	426	Crystalstructure of MltF from Pseudomonas aeruginosa complexed with cysteine [Pseudomonas aeruginosa PAO1],4OXV_A Crystal structure of MltF from Pseudomonas aeruginosa complexed with valine [Pseudomonas aeruginosa PADK2_CF510],4P0G_A Crystal structure of MltF from Pseudomonas aeruginosa complexed with bulgecin and muropeptide [Pseudomonas aeruginosa PAO1],4P11_A Native crystal structure of MltF Pseudomonas aeruginosa [Pseudomonas aeruginosa PAO1]
4OYV_A	6.46e-25	77	341	171	426	Crystalstructure of MltF from Pseudomonas aeruginosa complexed with leucine [Pseudomonas aeruginosa PAO1]
5AA4_B	2.57e-24	77	352	157	423	Crystalstructure of MltF from Pseudomonas aeruginosa in complex with cell-wall tetrapeptide [Pseudomonas aeruginosa BWHPSA013],5AA4_D Crystal structure of MltF from Pseudomonas aeruginosa in complex with cell-wall tetrapeptide [Pseudomonas aeruginosa BWHPSA013]
5AA4_A	2.57e-24	77	352	157	423	Crystalstructure of MltF from Pseudomonas aeruginosa in complex with cell-wall tetrapeptide [Pseudomonas aeruginosa BWHPSA013],5AA4_C Crystal structure of MltF from Pseudomonas aeruginosa in complex with cell-wall tetrapeptide [Pseudomonas aeruginosa BWHPSA013]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A8ZWR8	1.21e-32	114	341	213	446	Membrane-bound lytic murein transglycosylase F OS=Desulfococcus oleovorans (strain DSM 6200 / JCM 39069 / Hxd3) OX=96561 GN=mltF PE=3 SV=2
A0KJ50	1.56e-26	166	340	282	450	Membrane-bound lytic murein transglycosylase F OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049) OX=380703 GN=mltF PE=3 SV=1
A3QCH2	2.21e-25	171	341	267	438	Membrane-bound lytic murein transglycosylase F OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) OX=323850 GN=mltF PE=3 SV=1
A4VP14	1.12e-24	166	352	278	460	Membrane-bound lytic murein transglycosylase F OS=Pseudomonas stutzeri (strain A1501) OX=379731 GN=mltF PE=3 SV=2
Q02RN8	1.14e-24	77	352	196	461	Membrane-bound lytic murein transglycosylase F OS=Pseudomonas aeruginosa (strain UCBPP-PA14) OX=208963 GN=mltF PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.997702	0.002248	0.000029	0.000014	0.000007	0.000030

TMHMM  Annotations     

start	end
7	26