CAZyme Information: MGYG000003528_01347

Basic Information

• Species: CAAGGB01 sp900769285
• Lineage: Bacteria; Verrucomicrobiota; Lentisphaeria; UBA1407; UBA1407; CAAGGB01; CAAGGB01 sp900769285
• CAZyme ID: MGYG000003528_01347
• CAZy Family: GH63
• CAZyme Description: Cytoplasmic trehalase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
497		55845.97	5.7707

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003528	3662993	MAG	Fiji	Oceania

• Gene Location: Start: 15031; End: 16524 Strand: -

Full Sequence      

MQLNVPAPICDAHPGYLELYDLAWRLAHDHIRSIDGMPQNPYMDEAFCDTRIWIWDTCFM
ALFCKFAPDVFPGVESFRNLLDVIHGDATLPSVPVPDGEPSWTGAVPGTRAPILIQHPDN
PPLFAWAEHETALMTGDLNRLRHLLHDTRILQRHYDWLEAMHEPYTGGGVPTAWRARPDG
YLWCGICSGMDNTPRGRASSQDAGYPKRPFLWLDALAQQALSAHCIAAMATLIGDEDLAR
EWRQRHQQKTQLIQSLYWDDEDGFFHDIDAETHAHLPICTPAGFWPLLAGAATQAQADRC
AEKVASPDRLGGQTPWVSLARNDAMFEPAHGQYWRGAVWIPTAYAGCRGLLRYGHRDLAA
QTTAAILDTMLETYRTYEPHTIWECYAPSTPEPGRDARDQHRVRPDFCGWSALLPIAGLI
ENVIGLHHANAFTRQLHWDTPNSIRGRLGCRNYRFADITANLCIENGRCTVEADADFTLI
LNGVPHPIHHSDAFSLD

Enzyme Prediction     

No EC number prediction in MGYG000003528_01347.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK10137	PRK10137	1.01e-18	224	361	589	734	alpha-glucosidase; Provisional
pfam03200	Glyco_hydro_63	2.50e-12	38	414	90	488	Glycosyl hydrolase family 63 C-terminal domain. This is a family of eukaryotic enzymes belonging to glycosyl hydrolase family 63. They catalyze the specific cleavage of the non-reducing terminal glucose residue from Glc(3)Man(9)GlcNAc(2). Mannosyl oligosaccharide glucosidase EC:3.2.1.106 is the first enzyme in the N-linked oligosaccharide processing pathway. This family represents the C-terminal catalytic domain.
pfam01204	Trehalase	6.74e-11	226	359	318	448	Trehalase. Trehalase (EC:3.2.1.28) is known to recycle trehalose to glucose. Trehalose is a physiological hallmark of heat-shock response in yeast and protects of proteins and membranes against a variety of stresses. This family is found in conjunction with pfam07492 in fungi.
COG3408	GDB1	1.84e-09	119	427	339	611	Glycogen debranching enzyme (alpha-1,6-glucosidase) [Carbohydrate transport and metabolism].
PRK13270	treF	2.98e-09	226	394	362	521	alpha,alpha-trehalase TreF.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AVM44762.1	4.89e-181	4	483	98	581
AHF90735.1	1.40e-140	4	483	27	497
QZT38129.1	1.45e-132	6	483	33	488
AOW82330.1	5.30e-128	4	484	44	501
SDU91719.1	4.05e-127	4	483	14	468

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3W7S_A	1.09e-14	224	357	562	703	Escherichiacoli K12 YgjK complexed with glucose [Escherichia coli K-12],3W7S_B Escherichia coli K12 YgjK complexed with glucose [Escherichia coli K-12],3W7T_A Escherichia coli K12 YgjK complexed with mannose [Escherichia coli K-12],3W7T_B Escherichia coli K12 YgjK complexed with mannose [Escherichia coli K-12],3W7U_A Escherichia coli K12 YgjK complexed with galactose [Escherichia coli K-12],3W7U_B Escherichia coli K12 YgjK complexed with galactose [Escherichia coli K-12]
3W7W_A	1.09e-14	224	357	562	703	Crystalstructure of E. coli YgjK E727A complexed with 2-O-alpha-D-glucopyranosyl-alpha-D-galactopyranose [Escherichia coli K-12],3W7W_B Crystal structure of E. coli YgjK E727A complexed with 2-O-alpha-D-glucopyranosyl-alpha-D-galactopyranose [Escherichia coli K-12],5GW7_A Crystal structure of the glycosynthase mutant E727A of Escherichia coli GH63 glycosidase in complex with glucose and lactose [Escherichia coli K-12],5GW7_B Crystal structure of the glycosynthase mutant E727A of Escherichia coli GH63 glycosidase in complex with glucose and lactose [Escherichia coli K-12]
3W7X_A	1.09e-14	224	357	562	703	Crystalstructure of E. coli YgjK D324N complexed with melibiose [Escherichia coli K-12],3W7X_B Crystal structure of E. coli YgjK D324N complexed with melibiose [Escherichia coli K-12],5CA3_A Crystal structure of the glycosynthase mutant D324N of Escherichia coli GH63 glycosidase in complex with glucose and lactose [Escherichia coli K-12],5CA3_B Crystal structure of the glycosynthase mutant D324N of Escherichia coli GH63 glycosidase in complex with glucose and lactose [Escherichia coli K-12]
6XUX_A	1.20e-14	224	357	111	252	ChainA, Nanobody,Glucosidase YgjK,Glucosidase YgjK,Nanobody [Escherichia coli K-12]
7PQQ_B	1.20e-14	224	357	111	252	ChainB, Anti-RON nanobody,Megabody 91,Glucosidase YgjK [Lama glama]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P94250	3.02e-23	122	441	115	408	Uncharacterized protein BB_0381 OS=Borreliella burgdorferi (strain ATCC 35210 / DSM 4680 / CIP 102532 / B31) OX=224326 GN=BB_0381 PE=4 SV=2
P42592	6.06e-14	224	357	585	726	Glucosidase YgjK OS=Escherichia coli (strain K12) OX=83333 GN=ygjK PE=1 SV=1
P49381	3.90e-08	239	448	531	743	Cytosolic neutral trehalase OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) OX=284590 GN=NTH1 PE=1 SV=1
Q757L1	4.69e-07	234	409	510	686	Probable trehalase OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) OX=284811 GN=NTH2 PE=3 SV=1
A1AAC5	8.79e-06	226	374	348	488	Periplasmic trehalase OS=Escherichia coli O1:K1 / APEC OX=405955 GN=treA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000055	0.000005	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003528_01347.