CAZyme Information: MGYG000003528_01870

Basic Information

• Species: CAAGGB01 sp900769285
• Lineage: Bacteria; Verrucomicrobiota; Lentisphaeria; UBA1407; UBA1407; CAAGGB01; CAAGGB01 sp900769285
• CAZyme ID: MGYG000003528_01870
• CAZy Family: GH39
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
999	MGYG000003528_241|CGC1	110537.58	7.6348

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003528	3662993	MAG	Fiji	Oceania

• Gene Location: Start: 17673; End: 20672 Strand: -

Full Sequence      

MKRLCLCLLFGVLAATLPAQTYFEASDQPSTIINCGPRVAQARDILVDGRHVVLCSQNPD
QGAFIEIDIGGTTSRMRLTDAYRGRAEAEIYLPENANIRSFSLRLVDANSETFQLSFPKK
LTGLTGWQTLTLDVDFAKENPSSWGRTCNRRYDKPLRFSSVAASAADPAKPRAVAIRRLA
FVPTQAQPNIALDTNCPVHVLRPQDDATLALLVSNPCDTPMSLTGALTLTDAWKQQLHTA
PLNHTIQPGQTLRVPLPAPDRLGVFYVDIAAHDGVADVTRRLSFARMNPAGPTPGRSSGF
IFGVQSHALRYGPREQELDALAAGLMGAKVFRTSSNWGLAQPSPDNPPNFTVIDAMLDRY
AAQGLEPQIGFLNTPKWAVDPNWQPFSPTYVNRFGNRGFPAPDLKLYGRYVEQFMTHYRG
RVRFVESWNEPDLLSFANFGPDTYIEMMKVFYASVKKASPEALIMTGGYTSILQPFPSRS
THPDHMAYTMQGAKGHYDIHAFHAHGRFQHYAPQIVQLHEMQRRIGVNVPWWANETAESS
TGRGETIQAATLFKKLLYTFAMNGIGYNWYDLRNDGYDPKEPEHNFGLLTRDFYPKAAYA
TYNTLAALYAHAAFLKPLLVSEDFHAYLFQARNGDLLIPCWNTRENLPGRLLTLAGVTGA
LSVIDLFGNETPVKAAQGIAFINSTSWPVTIRLAGQRHFPTLHGNAFACPQQFAVHPARD
NTLELAFDNPLDQPLDLALKAVPSAGFRLPQDTFAVTVPPRQRHTFTLQLAADAHAKPSR
QAAVTLTLTLANALTQTHTIPLKTIDLLAATFAVHSGNNIRSLVVNAPDLSHLQWKGPED
LAADARLECQDNALVLTLDVTDDLHVQPHRGFNVWQGDNVQLALQLPGQTTCWEIGLTHL
ADGTSEAFVFKQPKNTPKDAVKRIRLTTARDDARKHTSYRAAIPLDALGIAPKDARQPIA
FTFIVNDNDADCRESYLFLTPGLGSGVHQPERYRLIAIE

Enzyme Prediction     

No EC number prediction in MGYG000003528_01870.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH39	349	645	2.6e-27	0.7215777262180975

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd09621	CBM9_like_5	6.29e-51	829	996	16	186	DOMON-like type 9 carbohydrate binding module. Family 9 carbohydrate-binding modules (CBM9) play a role in the microbial degradation of cellulose and hemicellulose (materials found in plants). The domain has previously been called cellulose-binding domain. The polysaccharide binding sites of CBMs with available 3D structure have been found to be either flat surfaces with interactions formed by predominantly aromatic residues (tryptophan and tyrosine), or extended shallow grooves. CBM9 domains found in this uncharacterized heterogeneous subfamily are often located at the C-terminus of longer proteins and may co-occur with various other functional domains such as glycosyl hydrolases. The CBM9 module in these architectures may be involved in binding to carbohydrates.
cd00241	DOMON_like	9.69e-11	827	976	4	155	Domon-like ligand-binding domains. DOMON-like domains can be found in all three kindgoms of life and are a diverse group of ligand binding domains that have been shown to interact with sugars and hemes. DOMON domains were initially thought to confer protein-protein interactions. They were subsequently found as a heme-binding motif in cellobiose dehydrogenase, an extracellular fungal oxidoreductase that degrades both lignin and cellulose, and in ethylbenzene dehydrogenase, an enzyme that aids in the anaerobic degradation of hydrocarbons. The domain interacts with sugars in the type 9 carbohydrate binding modules (CBM9), which are present in a variety of glycosyl hydrolases, and it can also be found at the N-terminus of sensor histidine kinases.
cd09619	CBM9_like_4	1.84e-10	823	971	18	163	DOMON-like type 9 carbohydrate binding module. Family 9 carbohydrate-binding modules (CBM9) play a role in the microbial degradation of cellulose and hemicellulose (materials found in plants). The domain has previously been called cellulose-binding domain. The polysaccharide binding sites of CBMs with available 3D structure have been found to be either flat surfaces with interactions formed by predominantly aromatic residues (tryptophan and tyrosine), or extended shallow grooves. CBM9 domains found in this uncharacterized heterogeneous subfamily are often located at the C-terminus of longer proteins and may co-occur with various other domains.
pfam01229	Glyco_hydro_39	3.56e-05	338	477	62	204	Glycosyl hydrolases family 39.
PHA03131	PHA03131	0.005	683	801	91	208	dUTPase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AHF94342.1	4.71e-192	71	986	98	1021
AHF90198.1	1.31e-165	86	997	87	1004
AVM46276.1	2.76e-124	194	984	334	1123
AVM47149.1	5.34e-122	194	999	498	1307
AVM44759.1	2.28e-118	190	999	162	965

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5JVK_A	3.22e-11	363	688	165	493	Structuralinsights into a family 39 glycoside hydrolase from the gut symbiont Bacteroides cellulosilyticus WH2. [Bacteroides cellulosilyticus],5JVK_B Structural insights into a family 39 glycoside hydrolase from the gut symbiont Bacteroides cellulosilyticus WH2. [Bacteroides cellulosilyticus],5JVK_C Structural insights into a family 39 glycoside hydrolase from the gut symbiont Bacteroides cellulosilyticus WH2. [Bacteroides cellulosilyticus]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000530	0.998589	0.000274	0.000214	0.000194	0.000186

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003528_01870.