CAZyme Information: MGYG000003528_02369

Basic Information

• Species: CAAGGB01 sp900769285
• Lineage: Bacteria; Verrucomicrobiota; Lentisphaeria; UBA1407; UBA1407; CAAGGB01; CAAGGB01 sp900769285
• CAZyme ID: MGYG000003528_02369
• CAZy Family: GH36
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
590	MGYG000003528_297|CGC1	66167.77	5.9501

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003528	3662993	MAG	Fiji	Oceania

• Gene Location: Start: 6800; End: 8572 Strand: +

Full Sequence      

MKKELICETTAVTLELESESWQVCGVVRRPEPQVMEYAYELTCAEASPVPHLRLTWTFPA
VDVCGRWTPSAFRSRTLPPNWGGPMHTELGISAPVMALFNQDGVNRETLAFSDAMSPVRV
KCGVNERTALMDCSVEAFWTAGAPVTSYRFTLRLDCRPVRYEAALGAVSSWWASMPSYAP
CPVPAEARQPVYSSWYVFHQDLQDTVIEEECALAKPYGMESIIVDDGWQTEDNHGGYAYC
GDWEMCLRRFPDMASHVAKVHALGLKYVLWYSMPWVGVKSRNYERFAGRYLYVNRGLGAA
ALDPRFPEVREFLIGIYEKAMREWDLDGFKLDFIDSFRFEGADPAVAENYAGRDCKSLAE
GVDRLLMGTMERLRAMKPEVMIEFRQSYIGPAMRKYGNMFRAADCPNDYVTNRVRTLDVR
MLAGSTAVHSDMLMWNRGETAVQASRQFTNILFSVPQISVRLKEIPAEHRAMLSFYLRLW
RENSDLLLDGALRAEQPENCFPVVSASKGRRQLTAVYAGRQVVPFAAQAGGELIVVNAGG
EGWVTLELSGAPVRSVSCFDCCGRRLEVSVPSAGLSRVSVPDGGVLKLYF

Enzyme Prediction     

No EC number prediction in MGYG000003528_02369.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd14791	GH36	2.16e-61	187	482	1	299	glycosyl hydrolase family 36 (GH36). GH36 enzymes occur in prokaryotes, eukaryotes, and archaea with a wide range of hydrolytic activities, including alpha-galactosidase, alpha-N-acetylgalactosaminidase, stachyose synthase, and raffinose synthase. All GH36 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein. GH36 members are retaining enzymes that cleave their substrates via an acid/base-catalyzed, double-displacement mechanism involving a covalent glycosyl-enzyme intermediate. Two aspartic acid residues have been identified as the catalytic nucleophile and the acid/base, respectively.
pfam02065	Melibiase	2.10e-09	188	383	41	236	Melibiase. Glycoside hydrolase families GH27, GH31 and GH36 form the glycoside hydrolase clan GH-D. Glycoside hydrolase family 36 can be split into 11 families, GH36A to GH36K. This family includes enzymes from GH36A-B and GH36D-K and from GH27.
cd06592	GH31_NET37	2.99e-09	188	333	1	151	glucosidase NET37. NET37 (also known as KIAA1161) is a human lamina-associated nuclear envelope transmembrane protein. A member of the glycosyl hydrolase family 31 (GH31) , it has been shown to be required for myogenic differentiation of C2C12 cells. Related proteins are found in eukaryotes and prokaryotes. Enzymes of the GH31 family possess a wide range of different hydrolytic activities including alpha-glucosidase (glucoamylase and sucrase-isomaltase), alpha-xylosidase, 6-alpha-glucosyltransferase, 3-alpha-isomaltosyltransferase and alpha-1,4-glucan lyase. All GH31 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein.
COG3345	GalA	7.73e-09	194	372	298	497	Alpha-galactosidase [Carbohydrate transport and metabolism].
cd14792	GH27	1.66e-06	192	294	5	106	glycosyl hydrolase family 27 (GH27). GH27 enzymes occur in eukaryotes, prokaryotes, and archaea with a wide range of hydrolytic activities, including alpha-glucosidase (glucoamylase and sucrase-isomaltase), alpha-N-acetylgalactosaminidase, and 3-alpha-isomalto-dextranase. All GH27 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein. GH27 members are retaining enzymes that cleave their substrates via an acid/base-catalyzed, double-displacement mechanism involving a covalent glycosyl-enzyme intermediate. Two aspartic acid residues have been identified as the catalytic nucleophile and the acid/base, respectively.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AVM46708.1	7.22e-195	4	590	2	587
CQR57728.1	2.42e-187	19	588	18	587
QTH41069.1	1.45e-183	20	588	20	588
AZS17022.1	3.32e-180	46	588	43	583
QMV40951.1	1.27e-177	52	588	50	585

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000070	0.000006	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003528_02369.