CAZyme Information: MGYG000003530_00538

Basic Information

• Species: RC9 sp004554455
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; UBA932; RC9; RC9 sp004554455
• CAZyme ID: MGYG000003530_00538
• CAZy Family: GH16
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
373	MGYG000003530_36|CGC1	41299.84	4.7079

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003530	2130921	MAG	Fiji	Oceania

• Gene Location: Start: 13096; End: 14217 Strand: +

Full Sequence      

MFALAASTAACSKPVNGYTDEHKVSTSPAALECGSEATTLQFEVSADASWQAYADDDCSS
WVSDVDPAWSASEKGTVSFKVAENLSRSPRSGSIVIKCGTTRHKLTVTQAAFVPEETVIQ
CPLEGYSLVWHDEFEDASVNSSNWRFENWPWYYVNSELQYYVAGGKLGNQETAYIEDGVL
CIKAQKADGSAKFNGTEDISGKVISARMNSRKSWKYAYMEASIWLPKGKGTWPAFWCMPD
DQSKGWPACGEIDIMEEVGVDPDIVSSSIHTTSYNHTKGTQKTANRKLSGAESGFHSYAL
EWTEDYIKTYVDGKHLFTFENDKAGNNDTWPFNKAFYMTLNLAWGGSWGGYAGVDESALP
CTMKVDYVRVFQK

Enzyme Prediction     

No EC number prediction in MGYG000003530_00538.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH16	130	371	4.7e-71	0.9956521739130435

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd08023	GH16_laminarinase_like	1.11e-83	130	371	1	235	Laminarinase, member of the glycosyl hydrolase family 16. Laminarinase, also known as glucan endo-1,3-beta-D-glucosidase, is a glycosyl hydrolase family 16 member that hydrolyzes 1,3-beta-D-glucosidic linkages in 1,3-beta-D-glucans such as laminarins, curdlans, paramylons, and pachymans, with very limited action on mixed-link (1,3-1,4-)-beta-D-glucans.
cd02182	GH16_Strep_laminarinase_like	1.31e-34	125	372	1	259	Streptomyces laminarinase-like, member of glycosyl hydrolase family 16. Proteins similar to Streptomyces sioyaensis beta-1,3-glucanase (laminarinase) present in Actinomycetales as well as Peziomycotina. Laminarinases belong to glycosyl hydrolase family 16 and hydrolyze the glycosidic bond of the 1,3-beta-linked glucan, a major component of fungal and plant cell walls and the structural and storage polysaccharides (laminarin) of marine macro-algae. Members of the GH16 family have a conserved jelly roll fold with an active site channel.
cd08024	GH16_CCF	4.00e-34	128	372	1	330	Coelomic cytolytic factor, member of glycosyl hydrolase family 16. Subgroup of glucanases of unknown function that are related to beta-GRP (beta-1,3-glucan recognition protein), but contain active site residues. Beta-GRPs are one group of pattern recognition receptors (PRRs), also referred to as biosensor proteins, that complexes with pathogen-associated beta-1,3-glucans and then transduces signals necessary for activation of an appropriate innate immune response. Beta-GRPs are present in insects and lack all catalytic residues. This subgroup contains related proteins that still contain the active site and are widely distributed in eukaryotes. Their structures adopt a jelly roll fold with a deep active site channel harboring the catalytic residues, like those of other glycosyl hydrolase family 16 members.
cd00413	Glyco_hydrolase_16	1.02e-30	132	371	1	210	glycosyl hydrolase family 16. The O-Glycosyl hydrolases are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A glycosyl hydrolase classification system based on sequence similarity has led to the definition of more than 95 different families inlcuding glycosyl hydrolase family 16. Family 16 includes lichenase, xyloglucan endotransglycosylase (XET), beta-agarase, kappa-carrageenase, endo-beta-1,3-glucanase, endo-beta-1,3-1,4-glucanase, and endo-beta-galactosidase, all of which have a conserved jelly roll fold with a deep active site channel harboring the catalytic residues.
COG2273	BglS	7.08e-24	106	370	13	262	Beta-glucanase, GH16 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADD61979.1	2.77e-106	16	373	23	366
ALJ43895.1	2.02e-105	16	373	20	363
QQA09221.1	2.23e-105	16	373	23	366
SCD18965.1	5.75e-105	4	373	14	363
QDO69449.1	1.17e-101	24	373	37	370

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6XOF_A	4.08e-65	126	373	24	268	ChainA, GH16 family protein [uncultured bacterium]
6XQF_A	2.28e-64	126	373	24	268	ChainA, GH16 family protein [uncultured bacterium],6XQG_A Chain A, GH16 family protein [uncultured bacterium],6XQH_A Chain A, GH16 family protein [uncultured bacterium],6XQL_A Chain A, GH16 family protein [uncultured bacterium],6XQM_A Chain A, GH16 family protein [uncultured bacterium]
3ILN_A	6.33e-59	123	372	2	248	ChainA, Laminarinase [Rhodothermus marinus],3ILN_B Chain B, Laminarinase [Rhodothermus marinus]
5WUT_A	1.44e-48	124	372	3	235	Crystalstructure of laminarinase from Flavobacterium sp. UMI-01 [Flavobacterium sp.],5WUT_B Crystal structure of laminarinase from Flavobacterium sp. UMI-01 [Flavobacterium sp.]
6JH5_A	4.23e-46	123	373	1	233	Structureof Marine bacterial laminarinase [Aquimarina]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P45798	2.73e-57	126	372	40	283	Beta-glucanase OS=Rhodothermus marinus OX=29549 GN=bglA PE=1 SV=1
P23903	8.90e-40	123	373	420	681	Glucan endo-1,3-beta-glucosidase A1 OS=Niallia circulans OX=1397 GN=glcA PE=1 SV=1
Q27082	2.22e-32	126	372	25	253	Clotting factor G alpha subunit OS=Tachypleus tridentatus OX=6853 PE=1 SV=1
Q9ZG90	2.54e-28	126	372	56	288	Keratan-sulfate endo-1,4-beta-galactosidase OS=Sphingobacterium multivorum OX=28454 PE=1 SV=1
C1IE32	6.73e-28	128	369	22	265	Glucan endo-1,3-beta-glucosidase OS=Cryptopygus antarcticus OX=187623 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.720953	0.099110	0.178992	0.000362	0.000207	0.000379

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003530_00538.