CAZyme Information: MGYG000003530_01266

Basic Information

• Species: RC9 sp004554455
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; UBA932; RC9; RC9 sp004554455
• CAZyme ID: MGYG000003530_01266
• CAZy Family: GH26
• CAZyme Description: Mannan endo-1,4-beta-mannosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
362		41136.96	4.5215

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003530	2130921	MAG	Fiji	Oceania

• Gene Location: Start: 20627; End: 21715 Strand: +

Full Sequence      

MKKTKLLSIALIAMTACTNKPASIEERLIEASGNIPLYGHQDDLMYGHDWNSADRLDKLM
ERSDVKDVCGKYPAILGLDLGHIELGDSCNLDGNDFALMAEAARQHHSRGGIISLSWHLD
NPATGGSSWDNSDSSVVCRILPHGDLHDKFRAWTDRVCDWIESLKDEDGRQIPVIWRPFH
EHTGGWFWWGASCCTPQEYNALWEMLYEQMVNERGLREMVWAISPSSSNRELFAERYPSD
EMVDLVGVDHYAYLAPGQSQEEADEAYIESTRELLAWLKEFAQAHGKPYALTETGLEGLD
SPEWWNGVLQKAIEGSGICYVLTWRNSSREDQRNHFYAPFPGQESADDFCKWIDEGKIKM
LD

Enzyme Prediction     

EC	3.2.1.100

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH26	30	329	1.2e-58	0.858085808580858

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam02156	Glyco_hydro_26	6.06e-36	28	251	16	230	Glycosyl hydrolase family 26.
COG4124	ManB2	2.34e-19	156	349	166	327	Beta-mannanase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ACA61146.1	5.15e-141	1	361	4	355
AIT97142.1	3.77e-140	10	361	15	362
SJX74202.1	2.00e-110	37	361	49	362
CAJ19136.1	2.23e-106	16	361	38	381
AGY54506.1	1.38e-105	19	354	24	353

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4ZXO_A	1.39e-98	18	361	9	336	Thestructure of a GH26 beta-mannanase from Bacteroides ovatus, BoMan26A. [Bacteroides ovatus]
2VX4_A	2.50e-72	15	362	36	389	CellvibrioJaponicus Mannanase Cjman26c Native Form [Cellvibrio japonicus],2VX6_A CELLVIBRIO JAPONICUS MANNANASE CJMAN26C Gal1Man4-BOUND FORM [Cellvibrio japonicus]
2VX5_A	2.50e-72	15	362	36	389	CellvibrioJaponicus Mannanase Cjman26c Mannose-Bound Form [Cellvibrio japonicus]
4CD4_A	4.67e-72	15	362	59	412	Thestructure of GH26 beta-mannanase CjMan26C from Cellvibrio japonicus in complex with ManIFG [Cellvibrio japonicus Ueda107],4CD5_A The structure of GH26 beta-mannanase CjMan26C from Cellvibrio japonicus in complex with ManMIm [Cellvibrio japonicus Ueda107]
2VX7_A	1.96e-71	15	362	36	389	CellvibrioJaponicus Mannanase Cjman26c Mannobiose-Bound Form [Cellvibrio japonicus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P49424	1.04e-39	37	339	74	381	Mannan endo-1,4-beta-mannosidase OS=Cellvibrio japonicus (strain Ueda107) OX=498211 GN=manA PE=1 SV=2
A1A278	2.98e-36	43	360	65	394	Mannan endo-1,4-beta-mannosidase OS=Bifidobacterium adolescentis (strain ATCC 15703 / DSM 20083 / NCTC 11814 / E194a) OX=367928 GN=BAD_1030 PE=1 SV=1
P55278	2.25e-23	41	324	53	322	Mannan endo-1,4-beta-mannosidase OS=Bacillus subtilis OX=1423 PE=3 SV=1
O05512	2.10e-22	46	326	66	326	Mannan endo-1,4-beta-mannosidase OS=Bacillus subtilis (strain 168) OX=224308 GN=gmuG PE=1 SV=2
P49425	8.78e-21	65	252	189	378	Mannan endo-1,4-beta-mannosidase OS=Rhodothermus marinus (strain ATCC 43812 / DSM 4252 / R-10) OX=518766 GN=manA PE=1 SV=3

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000000	1.000056	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003530_01266.