CAZyme Information: MGYG000003533_00252

Basic Information

• Species: SFTJ01 sp900769345
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; SFTJ01; SFTJ01 sp900769345
• CAZyme ID: MGYG000003533_00252
• CAZy Family: GH29
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
349		40546.07	6.604

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003533	2902010	MAG	Fiji	Oceania

• Gene Location: Start: 4993; End: 6042 Strand: +

Full Sequence      

MKLRIILGIAILMFVSLQVQSKDYILPEPATTPSKSQMKQIERRYGMFIHFGINTFHDQE
WTDGSKPASTYAPTAIDADQWIKAAKDAGMKYVILITKHHDGFCLWDSRYTAYDVASSGN
DTNVVEAVAKACKKYGIGLGLYYSLWDRKENGDVQNTADDAKYNEYMINQLEELLKMVKK
ITPVVEFWFDGGWVKQAYRWPTLDIYTTIKRHQPECQVGINWTIGSPENIDAHPVTPDKQ
QEGYPIRYFPSDFRLGDPYLPEDNDPKVFTHSGQSYYMPWESTICISQRWFYNTTDRTYK
TLDELEALYRRCTKNDNILIINCPPNREGRLRDKDVALLKQLRERLNLE

Enzyme Prediction     

No EC number prediction in MGYG000003533_00252.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH29	35	346	1.5e-71	0.8583815028901735

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam01120	Alpha_L_fucos	1.08e-52	44	342	26	324	Alpha-L-fucosidase.
smart00812	Alpha_L_fucos	3.61e-43	42	342	25	326	Alpha-L-fucosidase. O-Glycosyl hydrolases (EC 3.2.1.-) are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A classification system for glycosyl hydrolases, based on sequence similarity, has led to the definition of 85 different families. This classification is available on the CAZy (CArbohydrate-Active EnZymes) web site. Because the fold of proteins is better conserved than their sequences, some of the families can be grouped in 'clans'. Family 29 encompasses alpha-L-fucosidases, which is a lysosomal enzyme responsible for hydrolyzing the alpha-1,6-linked fucose joined to the reducing-end N-acetylglucosamine of the carbohydrate moieties of glycoproteins. Deficiency of alpha-L-fucosidase results in the lysosomal storage disease fucosidosis.
COG3669	AfuC	2.44e-39	33	349	11	315	Alpha-L-fucosidase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRO24265.1	2.16e-201	21	348	22	349
QTO26593.1	1.27e-196	4	348	3	347
QCQ30777.1	1.27e-196	4	348	3	347
QCQ35196.1	1.80e-196	4	348	3	347
QOD59462.1	1.67e-186	21	346	20	345

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4ZRX_A	4.85e-49	32	341	33	347	Crystalstructure of a putative alpha-L-fucosidase (BACOVA_04357) from Bacteroides ovatus ATCC 8483 at 1.59 A resolution [Bacteroides ovatus ATCC 8483]
3UES_A	1.24e-37	33	347	19	348	Crystalstructure of alpha-1,3/4-fucosidase from Bifidobacterium longum subsp. infantis complexed with deoxyfuconojirimycin [Bifidobacterium longum subsp. infantis ATCC 15697 = JCM 1222 = DSM 20088],3UES_B Crystal structure of alpha-1,3/4-fucosidase from Bifidobacterium longum subsp. infantis complexed with deoxyfuconojirimycin [Bifidobacterium longum subsp. infantis ATCC 15697 = JCM 1222 = DSM 20088]
3EYP_A	5.56e-37	33	341	10	317	Crystalstructure of putative alpha-L-fucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron],3EYP_B Crystal structure of putative alpha-L-fucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron],4OUE_A Crystal structure of an a-L-Fucosidase GH29 from Bacteroides thetaiotaomicron (BT2192) in complex with IPTG [Bacteroides thetaiotaomicron VPI-5482],4OUE_B Crystal structure of an a-L-Fucosidase GH29 from Bacteroides thetaiotaomicron (BT2192) in complex with IPTG [Bacteroides thetaiotaomicron VPI-5482],4OZO_A Crystal structure of an a-L-fucosidase GH29 from Bacteroides thetaiotaomicron (BT2192) in complex with oNPTG [Bacteroides thetaiotaomicron VPI-5482],4OZO_B Crystal structure of an a-L-fucosidase GH29 from Bacteroides thetaiotaomicron (BT2192) in complex with oNPTG [Bacteroides thetaiotaomicron VPI-5482]
6TR3_A	5.77e-37	33	344	28	360	Ruminococcusgnavus GH29 fucosidase E1_10125 in complex with fucose [[Ruminococcus] gnavus E1]
6ORG_A	8.33e-37	33	339	11	312	Crystalstructure of SpGH29 [Streptococcus pneumoniae TIGR4],6ORG_B Crystal structure of SpGH29 [Streptococcus pneumoniae TIGR4]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8GW72	7.98e-43	21	347	23	341	Alpha-L-fucosidase 1 OS=Arabidopsis thaliana OX=3702 GN=FUC1 PE=1 SV=2
Q7XUR3	8.79e-39	25	344	36	339	Putative alpha-L-fucosidase 1 OS=Oryza sativa subsp. japonica OX=39947 GN=Os04g0560400 PE=3 SV=2
P10901	9.15e-14	44	204	41	236	Alpha-L-fucosidase OS=Dictyostelium discoideum OX=44689 GN=alfA PE=3 SV=1
Q99KR8	5.45e-12	42	244	46	279	Plasma alpha-L-fucosidase OS=Mus musculus OX=10090 GN=Fuca2 PE=1 SV=1
P49713	2.42e-11	42	226	36	249	Putative alpha-L-fucosidase OS=Caenorhabditis elegans OX=6239 GN=W03G11.3 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000397	0.998845	0.000277	0.000152	0.000152	0.000144

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003533_00252.