CAZyme Information: MGYG000003533_01036

Basic Information

• Species: SFTJ01 sp900769345
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; SFTJ01; SFTJ01 sp900769345
• CAZyme ID: MGYG000003533_01036
• CAZy Family: GH141
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
781		88112.59	6.7022

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003533	2902010	MAG	Fiji	Oceania

• Gene Location: Start: 10201; End: 12546 Strand: +

Full Sequence      

MIRISVLLILLCLPLFNVLAQTTYFVSANALNKGNGSIERPFGSIAQALEHSKSDKGEIT
IYLRGGTYRLTETLRITAEHGNDSRHLTIKAYPGEKAVLSSGAKLNLHWEPYRDGIFMSP
ITEQHIMDVLVVDSAIRHMARYPNYDEKAVRFNGTSAMATDSTRVKGWKNPEGGYLHAMH
KHDWGDFHYRITGKDSHGKLSLEGGWQNNRPMGLHHDNRMVENIFEELDAPGEWYFDKAQ
KRLYYYPMPGEDIHKATFESPQLKHLIEIEGSESRPVKNVTIEGIDLTLTVRTFMEHYEQ
LLRSDWTIYRGACVIFRGTEHCAIKDCNIYNTGGNAVFFDKYNRHSSVSGTHFYAIGASA
VCFVGDVEGVKSPSFSYDEFVPLQDMDFSKGPKNQNHPAYCVVDNNLIHHIGLFEKQITG
VELSMCRNITVSHNSIYHTPRAGINISEGTWGGHNIEYNDIFNTVKETGDHGSINSWGRD
RFWNPDFGTMTKIVAEHKALILADILEPNIIRHNRLRCDRGWDIDLDDGSSNYHIYNNLC
LNGGIKLREGFYRTVENNIIINNTLHPHLWFKNNGDVFTRNIVMSEYKPISLYGWGAMVD
YNIFTDSVAYKAAQAWHNDAHSIVTPVKFANPLEGDYSVADDDPAVVIGGFRNFAMDRFG
VQTARLKELASTPVMSVPVVYSGVAKSQKVVWRGATLKSLETPGEQSATGMDEIRGVYVV
SVDALSSSVRDYIMPNDVILQINGTRIDNLQDMQRALADEKHGPLKLMIYRAQKTNDVVI
P

Enzyme Prediction     

No EC number prediction in MGYG000003533_01036.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH141	23	540	1.9e-60	0.9886148007590133

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd00987	PDZ_serine_protease	1.64e-11	694	780	4	90	PDZ domain of trypsin-like serine proteases, such as DegP/HtrA, which are oligomeric proteins involved in heat-shock response, chaperone function, and apoptosis. May be responsible for substrate recognition and/or binding, as most PDZ domains bind C-terminal polypeptides, though binding to internal (non-C-terminal) polypeptides and even to lipids has been demonstrated. In this subfamily of protease-associated PDZ domains a C-terminal beta-strand forms the peptide-binding groove base, a circular permutation with respect to PDZ domains found in Eumetazoan signaling proteins.
smart00228	PDZ	8.29e-08	710	771	21	83	Domain present in PSD-95, Dlg, and ZO-1/2. Also called DHR (Dlg homologous region) or GLGF (relatively well conserved tetrapeptide in these domains). Some PDZs have been shown to bind C-terminal polypeptides; others appear to bind internal (non-C-terminal) polypeptides. Different PDZs possess different binding specificities.
pfam13180	PDZ_2	1.03e-06	716	778	7	70	PDZ domain.
cd00989	PDZ_metalloprotease	1.03e-06	733	780	30	77	PDZ domain of bacterial and plant zinc metalloprotases, presumably membrane-associated or integral membrane proteases, which may be involved in signalling and regulatory mechanisms. May be responsible for substrate recognition and/or binding, as most PDZ domains bind C-terminal polypeptides, and binding to internal (non-C-terminal) polypeptides and even to lipids has been demonstrated. In this subfamily of protease-associated PDZ domains a C-terminal beta-strand forms the peptide-binding groove base, a circular permutation with respect to PDZ domains found in Eumetazoan signaling proteins.
cd00136	PDZ	6.90e-06	710	770	8	70	PDZ domain, also called DHR (Dlg homologous region) or GLGF (after a conserved sequence motif). Many PDZ domains bind C-terminal polypeptides, though binding to internal (non-C-terminal) polypeptides and even to lipids has been demonstrated. Heterodimerization through PDZ-PDZ domain interactions adds to the domain's versatility, and PDZ domain-mediated interactions may be modulated dynamically through target phosphorylation. Some PDZ domains play a role in scaffolding supramolecular complexes. PDZ domains are found in diverse signaling proteins in bacteria, archebacteria, and eurkayotes. This CD contains two distinct structural subgroups with either a N- or C-terminal beta-strand forming the peptide-binding groove base. The circular permutation placing the strand on the N-terminus appears to be found in Eumetazoa only, while the C-terminal variant is found in all three kingdoms of life, and seems to co-occur with protease domains. PDZ domains have been named after PSD95(post synaptic density protein), DlgA (Drosophila disc large tumor suppressor), and ZO1, a mammalian tight junction protein.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AWW32784.1	1.36e-218	24	781	33	796
BAU63437.1	1.64e-38	19	636	52	695
AWV97657.1	1.51e-35	21	660	26	707
QNN21980.1	5.67e-35	24	673	23	687
AFZ35556.1	1.60e-34	24	662	48	711

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5MQP_A	3.77e-13	44	449	51	501	Glycosidehydrolase BT_1002 [Bacteroides thetaiotaomicron],5MQP_B Glycoside hydrolase BT_1002 [Bacteroides thetaiotaomicron],5MQP_C Glycoside hydrolase BT_1002 [Bacteroides thetaiotaomicron],5MQP_D Glycoside hydrolase BT_1002 [Bacteroides thetaiotaomicron],5MQP_E Glycoside hydrolase BT_1002 [Bacteroides thetaiotaomicron],5MQP_F Glycoside hydrolase BT_1002 [Bacteroides thetaiotaomicron],5MQP_G Glycoside hydrolase BT_1002 [Bacteroides thetaiotaomicron],5MQP_H Glycoside hydrolase BT_1002 [Bacteroides thetaiotaomicron]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000361	0.998809	0.000278	0.000174	0.000172	0.000172

TMHMM  Annotations     

start	end
5	27