CAZyme Information: MGYG000003534_01442

Basic Information

• Species: Treponema_D sp900769325
• Lineage: Bacteria; Spirochaetota; Spirochaetia; Treponematales; Treponemataceae; Treponema_D; Treponema_D sp900769325
• CAZyme ID: MGYG000003534_01442
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
384		43581.74	8.4365

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003534	2560433	MAG	Fiji	Oceania

• Gene Location: Start: 36677; End: 37831 Strand: -

Full Sequence      

MQIVNNSSIIFGLYAIICLVVAVYFFTICTGNTIYIHKNTKKPLLKNGPKVSVLLPARNE
EKNLENCLNNLVSQDYQNYDIFVLDDNSTDRTLEIARWFEKNHSDKVHVIQGKSLPADWN
GKPYAMHQLVQAADGEILLFTDVDTKHKKSSVSFAVTNLLLNDVDMISGYIYEEMETFGE
KITVSAMFLLSALVVPLFFNGISKFSFFSNAIGQYIAVKADSFKKSGGYEVVKKVTTEDV
FLARNMKKCGFKTLFLDIKNQCSCRMYDGYINSVHGIGKNLFDFLGKSAPVLFLVLSAVV
IFLVLPPFFIYFAEGYPFWIKNALVFSTIFQILTWFILFYDRGNDTWLSCFYQLIFLNIV
IVGISSFCRTVSGKGFQWKGRTVS

Enzyme Prediction     

No EC number prediction in MGYG000003534_01442.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	52	179	5.1e-21	0.7235294117647059

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd04192	GT_2_like_e	1.66e-23	53	256	1	201	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
cd06423	CESA_like	5.37e-22	53	239	1	180	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.
cd00761	Glyco_tranf_GTA_type	3.46e-21	53	169	1	113	Glycosyltransferase family A (GT-A) includes diverse families of glycosyl transferases with a common GT-A type structural fold. Glycosyltransferases (GTs) are enzymes that synthesize oligosaccharides, polysaccharides, and glycoconjugates by transferring the sugar moiety from an activated nucleotide-sugar donor to an acceptor molecule, which may be a growing oligosaccharide, a lipid, or a protein. Based on the stereochemistry of the donor and acceptor molecules, GTs are classified as either retaining or inverting enzymes. To date, all GT structures adopt one of two possible folds, termed GT-A fold and GT-B fold. This hierarchy includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. The majority of the proteins in this superfamily are Glycosyltransferase family 2 (GT-2) proteins. But it also includes families GT-43, GT-6, GT-8, GT13 and GT-7; which are evolutionarily related to GT-2 and share structure similarities.
cd02525	Succinoglycan_BP_ExoA	6.38e-20	50	267	1	206	ExoA is involved in the biosynthesis of succinoglycan. Succinoglycan Biosynthesis Protein ExoA catalyzes the formation of a beta-1,3 linkage of the second sugar (glucose) of the succinoglycan with the galactose on the lipid carrie. Succinoglycan is an acidic exopolysaccharide that is important for invasion of the nodules. Succinoglycan is a high-molecular-weight polymer composed of repeating octasaccharide units. These units are synthesized on membrane-bound isoprenoid lipid carriers, beginning with galactose followed by seven glucose molecules, and modified by the addition of acetate, succinate, and pyruvate. ExoA is a membrane protein with a transmembrance domain at c-terminus.
cd06439	CESA_like_1	3.06e-19	41	169	18	144	CESA_like_1 is a member of the cellulose synthase (CESA) superfamily. This is a subfamily of cellulose synthase (CESA) superfamily. CESA superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members of the superfamily include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QQO08911.1	2.56e-105	5	384	2	381
AEF85916.1	5.50e-102	20	383	19	381
AIW89999.1	7.32e-98	23	383	18	385
ABL66344.1	1.03e-57	13	381	5	375
ACD91192.1	5.71e-56	13	381	5	377

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5TZE_C	7.49e-07	50	155	2	104	Crystalstructure of S. aureus TarS in complex with UDP-GlcNAc [Staphylococcus aureus],5TZE_E Crystal structure of S. aureus TarS in complex with UDP-GlcNAc [Staphylococcus aureus],5TZI_C Crystal structure of S. aureus TarS 1-349 [Staphylococcus aureus],5TZJ_A Crystal structure of S. aureus TarS 1-349 in complex with UDP-GlcNAc [Staphylococcus aureus],5TZJ_C Crystal structure of S. aureus TarS 1-349 in complex with UDP-GlcNAc [Staphylococcus aureus],5TZK_C Crystal structure of S. aureus TarS 1-349 in complex with UDP [Staphylococcus aureus]
5TZ8_A	1.01e-06	50	155	2	104	Crystalstructure of S. aureus TarS [Staphylococcus aureus],5TZ8_B Crystal structure of S. aureus TarS [Staphylococcus aureus],5TZ8_C Crystal structure of S. aureus TarS [Staphylococcus aureus]
6YV7_A	1.28e-06	49	144	43	137	MannosyltransferasePcManGT from Pyrobaculum calidifontis [Pyrobaculum calidifontis JCM 11548],6YV8_A Mannosyltransferase PcManGT from Pyrobaculum calidifontis in complex with GDP and Mn2+ [Pyrobaculum calidifontis JCM 11548],6YV9_B Mannosyltransferase PcManGT from Pyrobaculum calidifontis in complex with GDP-Man and Mn2+ [Pyrobaculum calidifontis JCM 11548]
6YV7_B	1.28e-06	49	144	42	136	MannosyltransferasePcManGT from Pyrobaculum calidifontis [Pyrobaculum calidifontis JCM 11548],6YV8_B Mannosyltransferase PcManGT from Pyrobaculum calidifontis in complex with GDP and Mn2+ [Pyrobaculum calidifontis JCM 11548],6YV9_A Mannosyltransferase PcManGT from Pyrobaculum calidifontis in complex with GDP-Man and Mn2+ [Pyrobaculum calidifontis JCM 11548]
5HEA_A	1.82e-06	45	144	1	94	CgTstructure in hexamer [Streptococcus parasanguinis FW213],5HEA_B CgT structure in hexamer [Streptococcus parasanguinis FW213],5HEA_C CgT structure in hexamer [Streptococcus parasanguinis FW213],5HEC_A CgT structure in dimer [Streptococcus parasanguinis FW213],5HEC_B CgT structure in dimer [Streptococcus parasanguinis FW213]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q4L977	9.85e-12	32	296	24	284	4,4'-diaponeurosporenoate glycosyltransferase OS=Staphylococcus haemolyticus (strain JCSC1435) OX=279808 GN=crtQ PE=3 SV=1
Q2YWE6	1.36e-09	37	290	27	275	4,4'-diaponeurosporenoate glycosyltransferase OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) OX=273036 GN=crtQ PE=3 SV=1
Q53590	2.43e-09	37	290	27	275	4,4'-diaponeurosporenoate glycosyltransferase OS=Staphylococcus aureus (strain Newman) OX=426430 GN=crtQ PE=3 SV=2
Q5HCY7	2.43e-09	37	290	27	275	4,4'-diaponeurosporenoate glycosyltransferase OS=Staphylococcus aureus (strain COL) OX=93062 GN=crtQ PE=3 SV=2
Q2FDU4	2.43e-09	37	290	27	275	4,4'-diaponeurosporenoate glycosyltransferase OS=Staphylococcus aureus (strain USA300) OX=367830 GN=crtQ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000085	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
10	32
182	199
291	313
318	340
350	372