CAZyme Information: MGYG000003534_02013

Basic Information

• Species: Treponema_D sp900769325
• Lineage: Bacteria; Spirochaetota; Spirochaetia; Treponematales; Treponemataceae; Treponema_D; Treponema_D sp900769325
• CAZyme ID: MGYG000003534_02013
• CAZy Family: GH23
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
714		82412.88	5.1383

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003534	2560433	MAG	Fiji	Oceania

• Gene Location: Start: 7659; End: 9803 Strand: -

Full Sequence      

MSVHRNFRYFFLILFSLFFSAFAFGCKARAENVSFYDSHYFKGLEFLKKGEILEAKKSFR
LCFDKGSYFCARKSGEELSKIGGRQEREKFCLEFLEKFNDEDALILACSEFFDNSEFAKV
LELTSGCDFLTSSGQLCYFRLCSLIEKNYKNLEETCELWFSSPQITKWHNKFYSEYLIDF
VREKDGKISLDENAEKKAELSFSEEFLELADFRIAVYRGNYKSAYAKISYIAEKYLENEA
VISQIGKACLYGSQEFSKNAGFFQKLAEKSDSKGVKFYSYFYAGRMFSKIQNRAALAEKC
FESAMKNALDGGQFDNALWYLLDSSLKISTERALSSLKKYCFSWDNPEYFDDFFEILTPL
LISENKWENFAELYKNLDGCASDETVAKFAWLYARSLQEKFIVLADEKEAETEISSALNR
SLSSGNEPYYKIMALNALSADEKNCEKVLCAEKTNFNFSRNEDAEKFLLGCMESGFAEKI
YPEYLNFCENGISISLEVSVKLSEYLKKSGDLNEKFYPESLRLASKAVLNAEKKLTKQQM
KIFYPRDFEKIVVSACEKYNLNEEHLFALIRTESFFDSGIKSSAGAVGLTQLMESTASDI
SKKLKWRDFDLKDSVQNVEMGAFYLAELIRRLDGKVLPAFFSYNAGITKVRRWMENSKIE
LGYQKILPLDLFLETIPYEETRGYGRKLVSASVYYAWLYEGKSVCEVVEEIFGR

Enzyme Prediction     

No EC number prediction in MGYG000003534_02013.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	564	690	9.9e-19	0.7555555555555555

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd13401	Slt70-like	2.08e-54	544	698	2	152	70kDa soluble lytic transglycosylase (Slt70) and similar proteins. Catalytic domain of the 70kda soluble lytic transglycosylase (LT)-like proteins, which also have an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.
cd16896	LT_Slt70-like	5.43e-35	545	687	1	139	uncharacterized lytic transglycosylase subfamily with similarity to Slt70. Uncharacterized lytic transglycosylase (LT) with a conserved sequence pattern suggesting similarity to the Slt70, a 70kda soluble lytic transglycosylase which also has an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd00254	LT-like	3.68e-25	566	691	4	109	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
pfam01464	SLT	8.76e-25	555	658	4	107	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.
COG0741	MltE	2.40e-23	544	702	135	290	Soluble lytic murein transglycosylase and related regulatory proteins (some contain LysM/invasin domains) [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNL96492.1	1.32e-169	5	714	2	698
QTQ12688.1	3.59e-150	37	711	37	705
QTQ13093.1	3.14e-148	13	711	12	705
QTQ15335.1	7.19e-141	78	711	1	628
QQA00706.1	1.09e-133	25	714	23	678

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5MPQ_A	6.26e-20	527	699	395	559	BulgecinA: The key to a broad-spectrum inhibitor that targets lytic transglycosylases [Neisseria meningitidis]
5O1J_A	6.35e-20	527	699	399	563	Lytictransglycosylase in action [Neisseria meningitidis MC58]
6FPN_B	6.48e-20	527	699	405	569	Lytictransglycosylase in action [Neisseria meningitidis MC58]
5O24_A	6.56e-20	527	699	409	573	Lytictransglycosylase in action [Neisseria meningitidis]
5O29_A	6.69e-20	527	699	415	579	Lytictransglycosylase in action [Neisseria meningitidis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O31608	7.66e-13	549	696	61	181	Putative murein lytic transglycosylase YjbJ OS=Bacillus subtilis (strain 168) OX=224308 GN=yjbJ PE=3 SV=1
P39434	1.27e-11	544	695	476	625	Soluble lytic murein transglycosylase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=slt PE=3 SV=2
P44888	2.06e-11	493	695	385	572	Putative soluble lytic murein transglycosylase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=slt PE=3 SV=1
P0AGC3	1.53e-10	563	702	495	632	Soluble lytic murein transglycosylase OS=Escherichia coli (strain K12) OX=83333 GN=slt PE=1 SV=1
P0AGC4	1.53e-10	563	702	495	632	Soluble lytic murein transglycosylase OS=Escherichia coli O157:H7 OX=83334 GN=slt PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.001359	0.344062	0.653776	0.000520	0.000163	0.000121

TMHMM  Annotations     

start	end
7	26