CAZyme Information: MGYG000003535_00404

Basic Information

• Species: Prevotella sp004556065
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella sp004556065
• CAZyme ID: MGYG000003535_00404
• CAZy Family: CE8
• CAZyme Description: Pectinesterase A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
323	MGYG000003535_19|CGC1	36388.1	6.6348

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003535	2652504	MAG	Fiji	Oceania

• Gene Location: Start: 7740; End: 8711 Strand: -

Full Sequence      

MRKTILTIIMSIIGIITMDAQSMSFDFIVAKDGSGTHTTLQSAINDVPDYRKKETRIFIS
EGVYHEKIVIPESKQNVSLIGEKEGKVVVEFDDFAQKKNSFGEEKGTSGSASFYVYGHDF
HATNIVFANTAGPVGQAVAMFVSGNRAVFNNCRFKGFQDTLYTYGKQSKQLYKNCYIEGT
VDFIFGSSTAYFLNCKIHCLRNGYITAASTPENVKYGYVFRYCTITAEKEVTGEVFLGRP
WRPYAKTVFIECTMGKFINSEGWNNWGSTEKEKTVTYGEADSYDFDGNIIDLSKRVAWAK
TVNPDDYAIDKVLADNDKPEWYK

Enzyme Prediction     

No EC number prediction in MGYG000003535_00404.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE8	27	305	4.1e-96	0.9479166666666666

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam01095	Pectinesterase	3.38e-79	26	308	1	286	Pectinesterase.
PLN02773	PLN02773	2.39e-74	29	321	9	305	pectinesterase
PLN02682	PLN02682	7.91e-67	24	306	68	351	pectinesterase family protein
PLN02665	PLN02665	1.31e-62	29	305	72	343	pectinesterase family protein
PLN02304	PLN02304	1.63e-62	27	303	77	355	probable pectinesterase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QEC43391.1	6.01e-119	19	315	21	316
APU94947.1	1.02e-117	24	300	22	294
BAV04506.1	1.15e-115	25	320	251	544
QQT36707.1	1.85e-115	1	306	1	300
QQS94306.1	1.85e-115	1	306	1	300

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1XG2_A	2.97e-41	28	298	6	277	ChainA, Pectinesterase 1 [Solanum lycopersicum]
1GQ8_A	1.88e-38	28	298	10	281	Pectinmethylesterase from Carrot [Daucus carota]
5C1E_A	8.59e-28	35	263	17	245	CrystalStructure of the Pectin Methylesterase from Aspergillus niger in Penultimately Deglycosylated Form (N-acetylglucosamine Stub at Asn84) [Aspergillus niger ATCC 1015]
5C1C_A	4.44e-27	35	263	17	245	CrystalStructure of the Pectin Methylesterase from Aspergillus niger in Deglycosylated Form [Aspergillus niger ATCC 1015]
2NSP_A	9.30e-27	24	315	3	336	ChainA, Pectinesterase A [Dickeya dadantii 3937],2NSP_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NST_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NST_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT6_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT6_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT9_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT9_B Chain B, Pectinesterase A [Dickeya dadantii 3937]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9LVQ0	9.29e-56	29	306	9	286	Pectinesterase 31 OS=Arabidopsis thaliana OX=3702 GN=PME31 PE=1 SV=1
Q8VYZ3	1.00e-50	31	323	90	382	Probable pectinesterase 53 OS=Arabidopsis thaliana OX=3702 GN=PME53 PE=2 SV=1
O23038	1.77e-50	18	309	83	375	Probable pectinesterase 8 OS=Arabidopsis thaliana OX=3702 GN=PME8 PE=2 SV=2
Q9FM79	5.09e-50	28	306	83	362	Pectinesterase QRT1 OS=Arabidopsis thaliana OX=3702 GN=QRT1 PE=1 SV=1
P41510	1.71e-48	28	300	274	550	Probable pectinesterase/pectinesterase inhibitor OS=Brassica napus OX=3708 GN=BP19 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000496	0.998678	0.000224	0.000212	0.000195	0.000183

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003535_00404.