CAZyme Information: MGYG000003535_00583

Basic Information

• Species: Prevotella sp004556065
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella sp004556065
• CAZyme ID: MGYG000003535_00583
• CAZy Family: GH5
• CAZyme Description: Endoglucanase A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
365	MGYG000003535_26|CGC1	41761.09	6.5008

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003535	2652504	MAG	Fiji	Oceania

• Gene Location: Start: 52056; End: 53153 Strand: +

Full Sequence      

MKSANTLRKTGIATICLIACLHSASAQEFEKARDAVNSMRIGWNLGNTLDATGKRDKKLS
SPTDWETSCGQPVTTREMIHEFKLRGFNVIRIPVTWYPHLNDNDSIDRKWMDRVAEIIDY
VIDDGMYCIVNIHHDTGTHGWLNADPENYPAISRRFKAIWHQIAVRFRNYGERLLFEGFN
EMLDKDGKWDHSTTGNYAAINLLAQDFVDVVRATGGNNEWRNLIVTTYSANGGETTLSNY
RVPGDKHPGHIIGEVHFYDPQDFCFPENKPTVYTEEFREISRQVINRVADHFDSIGIPVI
IGEIAAFDKGNTAERVKFSRFVASETKRRGMTIVWWMGLIDRKSCRWSEPEIVDALLEGI
DTRQQ

Enzyme Prediction     

No EC number prediction in MGYG000003535_00583.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	66	337	3e-89	0.9818840579710145

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00150	Cellulase	3.97e-52	49	336	1	266	Cellulase (glycosyl hydrolase family 5).
COG2730	BglC	4.27e-21	42	336	54	357	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRX63738.1	2.60e-113	28	357	144	476
QPB75690.1	1.75e-92	24	358	136	499
AEX97596.1	5.92e-90	32	364	35	383
ACA61144.1	3.85e-88	27	361	142	508
ACA61160.1	1.79e-87	30	359	150	511

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5D9N_A	2.58e-83	30	359	11	350	Crystalstructure of PbGH5A, a glycoside hydrolase family 5 member from Prevotella bryantii B14, in complex with the xyloglucan heptasaccharide XXXG [Prevotella bryantii],5D9N_B Crystal structure of PbGH5A, a glycoside hydrolase family 5 member from Prevotella bryantii B14, in complex with the xyloglucan heptasaccharide XXXG [Prevotella bryantii],5D9P_A Crystal structure of PbGH5A, a glycoside hydrolase family 5 enzyme from Prevotella bryantii B14, in complex with an inhibitory N-bromoacetylglycosylamine derivative of XXXG [Prevotella bryantii],5D9P_B Crystal structure of PbGH5A, a glycoside hydrolase family 5 enzyme from Prevotella bryantii B14, in complex with an inhibitory N-bromoacetylglycosylamine derivative of XXXG [Prevotella bryantii]
5D9M_A	2.05e-82	30	359	11	350	Crystalstructure of PbGH5A, a glycoside hydrolase family 5 enzyme from Prevotella bryantii B14, E280A mutant in complex with the xyloglucan tetradecasaccharide XXXGXXXG [Prevotella bryantii],5D9M_B Crystal structure of PbGH5A, a glycoside hydrolase family 5 enzyme from Prevotella bryantii B14, E280A mutant in complex with the xyloglucan tetradecasaccharide XXXGXXXG [Prevotella bryantii],5D9O_A Crystal structure of PbGH5A, a glycoside hydrolase family 5 enzyme from Prevotella bryantii B14, E280A mutant in complex with cellotetraose [Prevotella bryantii],5D9O_B Crystal structure of PbGH5A, a glycoside hydrolase family 5 enzyme from Prevotella bryantii B14, E280A mutant in complex with cellotetraose [Prevotella bryantii]
6D2W_A	6.36e-79	30	359	434	773	Crystalstructure of Prevotella bryantii endo-beta-mannanase/endo-beta-glucanase PbGH26A-GH5A [Prevotella bryantii B14],6D2W_B Crystal structure of Prevotella bryantii endo-beta-mannanase/endo-beta-glucanase PbGH26A-GH5A [Prevotella bryantii B14]
3VDH_A	1.64e-78	30	359	11	350	Crystalstructure of PbGH5A, a glycoside hydrolase family 5 enzyme from Prevotella bryantii B14 [Prevotella bryantii],3VDH_B Crystal structure of PbGH5A, a glycoside hydrolase family 5 enzyme from Prevotella bryantii B14 [Prevotella bryantii]
6WQP_A	2.35e-72	32	358	16	354	GH5-4broad specificity endoglucanase from Ruminococcus champanellensis [Ruminococcus champanellensis],6WQP_B GH5-4 broad specificity endoglucanase from Ruminococcus champanellensis [Ruminococcus champanellensis],6WQV_A GH5-4 broad specificity endoglucanase from Ruminococcus champanellensis with bound cellotriose [Ruminococcus champanellensis],6WQV_B GH5-4 broad specificity endoglucanase from Ruminococcus champanellensis with bound cellotriose [Ruminococcus champanellensis],6WQV_C GH5-4 broad specificity endoglucanase from Ruminococcus champanellensis with bound cellotriose [Ruminococcus champanellensis],6WQV_D GH5-4 broad specificity endoglucanase from Ruminococcus champanellensis with bound cellotriose [Ruminococcus champanellensis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P54937	1.96e-68	26	359	33	377	Endoglucanase A OS=Clostridium longisporum OX=1523 GN=celA PE=1 SV=1
P23660	1.25e-64	32	359	27	362	Endoglucanase A OS=Ruminococcus albus OX=1264 GN=celA PE=1 SV=1
P28623	4.90e-64	12	360	18	372	Endoglucanase D OS=Clostridium cellulovorans (strain ATCC 35296 / DSM 3052 / OCM 3 / 743B) OX=573061 GN=engD PE=1 SV=2
P17901	1.51e-63	36	358	51	398	Endoglucanase A OS=Ruminiclostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10) OX=394503 GN=celCCA PE=1 SV=1
P28621	2.75e-62	32	364	42	378	Endoglucanase B OS=Clostridium cellulovorans (strain ATCC 35296 / DSM 3052 / OCM 3 / 743B) OX=573061 GN=engB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000397	0.998788	0.000199	0.000224	0.000182	0.000171

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003535_00583.