CAZyme Information: MGYG000003535_01244

Basic Information

• Species: Prevotella sp004556065
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella sp004556065
• CAZyme ID: MGYG000003535_01244
• CAZy Family: CE8
• CAZyme Description: Pectinesterase A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
336	MGYG000003535_46|CGC5	38040.22	7.8963

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003535	2652504	MAG	Fiji	Oceania

• Gene Location: Start: 122157; End: 123167 Strand: +

Full Sequence      

MMKKLILSLLALTAMTNMQAANKYDNPDTLFVSRDGTCEFRNIADAIEVCRAFMEYHKVI
FVRNGVYKEKIEVPTWLTNIEICGEDRDKTIITWDDHANIRLKGTEIKMGTFRTYTVKVT
GSQITFKNITIENNAARLGQAVALHVEGDKCKFVNCRFLGNQDTIYTGRGGVRQFFKDCY
IEGTTDFIFGPSTVWFEHCDIVNKINSYVTAASTPKDVAYGYVFNNCTVRCLEGSEATKS
NGGKAIDKCYLGRPWRPYAYTLFMNCNLGCHITPAGWHNWGNKDNELTARYYEYNNSGEG
AAKTERAPWTRQLTKKEAKAITYGTVFGGETAWLDD

Enzyme Prediction     

No EC number prediction in MGYG000003535_01244.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE8	31	326	6.5e-96	0.9791666666666666

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PLN02773	PLN02773	4.35e-76	30	318	7	287	pectinesterase
pfam01095	Pectinesterase	4.85e-71	32	330	4	298	Pectinesterase.
PLN02682	PLN02682	3.29e-62	20	319	61	353	pectinesterase family protein
PLN02304	PLN02304	1.40e-58	27	334	69	374	probable pectinesterase
PLN02708	PLN02708	1.42e-55	32	316	245	532	Probable pectinesterase/pectinesterase inhibitor

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS84477.1	4.37e-155	2	334	1	322
AGB28242.1	1.57e-152	2	334	1	322
QVJ81978.1	3.04e-152	2	333	1	320
ADE82952.1	3.04e-152	2	333	1	320
QJR97878.1	5.04e-150	21	333	13	316

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1GQ8_A	6.45e-40	32	334	11	308	Pectinmethylesterase from Carrot [Daucus carota]
5C1E_A	4.26e-39	30	335	11	296	CrystalStructure of the Pectin Methylesterase from Aspergillus niger in Penultimately Deglycosylated Form (N-acetylglucosamine Stub at Asn84) [Aspergillus niger ATCC 1015]
5C1C_A	2.29e-38	30	335	11	296	CrystalStructure of the Pectin Methylesterase from Aspergillus niger in Deglycosylated Form [Aspergillus niger ATCC 1015]
1XG2_A	5.07e-37	32	309	7	277	ChainA, Pectinesterase 1 [Solanum lycopersicum]
2NSP_A	4.78e-34	33	334	12	341	ChainA, Pectinesterase A [Dickeya dadantii 3937],2NSP_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NST_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NST_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT6_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT6_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT9_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT9_B Chain B, Pectinesterase A [Dickeya dadantii 3937]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9LVQ0	2.58e-59	32	318	9	287	Pectinesterase 31 OS=Arabidopsis thaliana OX=3702 GN=PME31 PE=1 SV=1
O23038	1.14e-52	25	334	86	388	Probable pectinesterase 8 OS=Arabidopsis thaliana OX=3702 GN=PME8 PE=2 SV=2
Q5MFV6	1.36e-49	29	336	276	579	Probable pectinesterase/pectinesterase inhibitor VGDH2 OS=Arabidopsis thaliana OX=3702 GN=VGDH2 PE=2 SV=2
P41510	1.28e-47	29	326	272	563	Probable pectinesterase/pectinesterase inhibitor OS=Brassica napus OX=3708 GN=BP19 PE=2 SV=1
Q42608	2.85e-46	29	326	259	550	Pectinesterase/pectinesterase inhibitor (Fragment) OS=Brassica campestris OX=3711 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000231	0.999152	0.000177	0.000146	0.000140	0.000132

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003535_01244.