CAZyme Information: MGYG000003535_01701

Basic Information

• Species: Prevotella sp004556065
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella sp004556065
• CAZyme ID: MGYG000003535_01701
• CAZy Family: GH105
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
439		50442.48	6.2354

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003535	2652504	MAG	Fiji	Oceania

• Gene Location: Start: 13187; End: 14506 Strand: +

Full Sequence      

MKNILTSIIMLSAMTAAAQDVVNDATAPLHLMKPAYKYTYGLTSQKDVKASIDRIYDYLN
KTTFAELDETGKQLRRGDFRLTSYEWGVTYSAMIRAGELTGDNRYTRYAIDRMSFLAEQA
PRFIKMKERGENIDPLMEQVVSPDALDDCGAICSAMIKTRNRGYSQMGVKDKKLWDEQIE
RYYDFIMNKEHRYTDGQFARLRPVKNTVWLDDMFMGIPALALNGNWEEAMKQFRLFREKM
WVAEKQLYRHGWTPTKDGYHPSFFWGRANGWALLTVCEMLDVKEDDFLKDCLKQHLNGLL
ALQGHDGAWHQLLDRNDTYLETSCTAIYAYCLAHAINKGWIEPEPYIGQTLLAWNYVQAH
ITEKGQVEGTCVGTGLAFDPAFYAYRPVNNYAAHGYGPTLWAGAEIYHLLGSMCIKMNDS
AVHYYPEDPATDEPIFYVK

Enzyme Prediction     

EC	3.2.1.172

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	81	407	1.5e-70	0.9608433734939759

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07470	Glyco_hydro_88	8.54e-64	52	410	2	343	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.
COG4225	YesR	5.17e-31	68	405	13	352	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADY37528.1	2.80e-162	5	436	7	460
QUT69874.1	4.24e-162	10	438	11	462
QQA07687.1	4.24e-162	10	438	11	462
QUT42072.1	6.01e-162	10	438	11	462
AII64718.1	1.05e-161	7	438	11	465

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3K11_A	1.47e-156	21	438	5	442	Crystalstructure of Putative glycosyl hydrolase (NP_813087.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 1.80 A resolution [Bacteroides thetaiotaomicron VPI-5482]
3QWT_A	1.34e-19	227	390	192	361	ChainA, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_B Chain B, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_C Chain C, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_D Chain D, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A]
1NC5_A	2.49e-18	84	412	41	370	Structureof Protein of Unknown Function of YteR from Bacillus Subtilis [Bacillus subtilis],2D8L_A Crystal Structure of Unsaturated Rhamnogalacturonyl Hydrolase in complex with dGlcA-GalNAc [Bacillus subtilis]
2GH4_A	1.01e-17	84	412	31	360	ChainA, Putative glycosyl hydrolase yteR [Bacillus subtilis]
3PMM_A	4.30e-15	227	390	193	362	ChainA, Putative cytoplasmic protein [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O34559	1.36e-17	84	412	41	370	Unsaturated rhamnogalacturonyl hydrolase YteR OS=Bacillus subtilis (strain 168) OX=224308 GN=yteR PE=1 SV=1
O31521	6.78e-16	184	406	103	335	Unsaturated rhamnogalacturonyl hydrolase YesR OS=Bacillus subtilis (strain 168) OX=224308 GN=yesR PE=1 SV=1
P0A3U6	3.89e-11	227	405	20	227	Protein Atu3128 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) OX=176299 GN=Atu3128 PE=3 SV=1
P0A3U7	3.89e-11	227	405	20	227	24.9 kDa protein in picA locus OS=Rhizobium radiobacter OX=358 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000291	0.999048	0.000174	0.000164	0.000153	0.000136

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003535_01701.