CAZyme Information: MGYG000003536_01344

Basic Information

• Lineage: Bacteria; Verrucomicrobiota; Verrucomicrobiae; Opitutales; CAG-312; CAG-312
• CAZyme ID: MGYG000003536_01344
• CAZy Family: GH109
• CAZyme Description: Inositol 2-dehydrogenase/D-chiro-inositol 3-dehydrogenase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
438		47645.04	8.3255

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003536	1804941	MAG	Fiji	Oceania

• Gene Location: Start: 1764; End: 3080 Strand: +

Full Sequence      

MGAVLGASAVLPKFSFASAKGGDRIKVGIIGCGGRATGAAQNMLSADSNVEFVAFADLFA
DKIDPSIKKIQAKAAQVCPKDADKIINPARVQKFSGWDCVDKLLAIGEIDVVIEATPPVF
RTPHYGKIVAAGKHAFLEKPACIDITQAREMLELAAEADKKGLCVVCGTQRRYHDGYKEV
VKRVHDGMIGEPISAQCYWNMGGYVGHNQHDKMEKEGLLKGLAPDDMEYQIRNWFSFIWS
SGDHIVEQHVHNIDVIMWALGDNRNPVSVRGMGGRSTDLPVPVYGDRFSHFAVDFDMGDG
LFLSSYCQQDPGAAGEVGERVVGTKGIMTTSLWGGACKITDLKGNVLYAAPEKVPQCLEM
EHKFLLDAIRAGRHVNTLPTLVNSTLLAIAGRMSAFSGKKFKYEWMLKKSKESLVPKTLG
FVKNPVAGVPVPGKYRLS

Enzyme Prediction     

EC	3.2.1.18

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH109	23	198	7.3e-16	0.39849624060150374

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG0673	MviM	7.64e-33	24	400	3	337	Predicted dehydrogenase [General function prediction only].
TIGR04380	myo_inos_iolG	4.22e-15	24	194	1	147	inositol 2-dehydrogenase. All members of the seed alignment for this model are known or predicted inositol 2-dehydrogenase sequences co-clustered with other enzymes for catabolism of myo-inositol or closely related compounds. Inositol 2-dehydrogenase catalyzes the first step in inositol catabolism. Members of this family may vary somewhat in their ranges of acceptable substrates and some may act on analogs to myo-inositol rather than myo-inositol per se. [Energy metabolism, Sugars]
pfam01408	GFO_IDH_MocA	5.17e-13	25	161	1	115	Oxidoreductase family, NAD-binding Rossmann fold. This family of enzymes utilize NADP or NAD. This family is called the GFO/IDH/MOCA family in swiss-prot.
PRK11579	PRK11579	6.90e-05	23	191	3	144	putative oxidoreductase; Provisional
COG4091	COG4091	1.17e-04	17	163	10	153	Predicted homoserine dehydrogenase, contains C-terminal SAF domain [Amino acid transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AQT66975.1	3.24e-98	19	434	36	421
AWI08226.1	1.50e-94	11	433	25	425
AOS46431.1	1.60e-94	19	434	35	428
ARU41414.1	4.92e-90	3	438	16	417
ADV63049.1	2.92e-89	7	434	19	418

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4N54_A	2.94e-08	21	328	11	269	ChainA, Inositol dehydrogenase [Lacticaseibacillus casei BL23],4N54_B Chain B, Inositol dehydrogenase [Lacticaseibacillus casei BL23],4N54_C Chain C, Inositol dehydrogenase [Lacticaseibacillus casei BL23],4N54_D Chain D, Inositol dehydrogenase [Lacticaseibacillus casei BL23]
3HNP_A	6.96e-08	100	233	57	199	CrystalStructure of an Oxidoreductase from Bacillus cereus. Northeast Structural Genomics Consortium target id BcR251 [Bacillus cereus ATCC 14579],3HNP_B Crystal Structure of an Oxidoreductase from Bacillus cereus. Northeast Structural Genomics Consortium target id BcR251 [Bacillus cereus ATCC 14579],3HNP_C Crystal Structure of an Oxidoreductase from Bacillus cereus. Northeast Structural Genomics Consortium target id BcR251 [Bacillus cereus ATCC 14579],3HNP_D Crystal Structure of an Oxidoreductase from Bacillus cereus. Northeast Structural Genomics Consortium target id BcR251 [Bacillus cereus ATCC 14579],3HNP_E Crystal Structure of an Oxidoreductase from Bacillus cereus. Northeast Structural Genomics Consortium target id BcR251 [Bacillus cereus ATCC 14579],3HNP_F Crystal Structure of an Oxidoreductase from Bacillus cereus. Northeast Structural Genomics Consortium target id BcR251 [Bacillus cereus ATCC 14579]
4MKX_A	7.01e-08	25	328	18	272	ChainA, Inositol dehydrogenase [Lacticaseibacillus casei BL23],4MKZ_A Chain A, Inositol dehydrogenase [Lacticaseibacillus casei BL23]
3NT2_A	2.11e-07	25	269	3	194	Crystalstructure of myo-inositol dehydrogenase from Bacillus subtilis with bound cofactor [Bacillus subtilis],3NT2_B Crystal structure of myo-inositol dehydrogenase from Bacillus subtilis with bound cofactor [Bacillus subtilis],3NT4_A Crystal structure of myo-inositol dehydrogenase from Bacillus subtilis with bound cofactor NADH and inositol [Bacillus subtilis],3NT4_B Crystal structure of myo-inositol dehydrogenase from Bacillus subtilis with bound cofactor NADH and inositol [Bacillus subtilis],3NT5_A Crystal structure of myo-inositol dehydrogenase from Bacillus subtilis with bound cofactor and product inosose [Bacillus subtilis],3NT5_B Crystal structure of myo-inositol dehydrogenase from Bacillus subtilis with bound cofactor and product inosose [Bacillus subtilis]
3MZ0_A	4.97e-07	25	269	3	194	Crystalstructure of apo myo-inositol dehydrogenase from Bacillus subtilis [Bacillus subtilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A7ZAH5	6.52e-07	25	269	3	194	Inositol 2-dehydrogenase/D-chiro-inositol 3-dehydrogenase OS=Bacillus velezensis (strain DSM 23117 / BGSC 10A6 / LMG 26770 / FZB42) OX=326423 GN=iolG PE=3 SV=1
P26935	1.15e-06	25	269	3	194	Inositol 2-dehydrogenase/D-chiro-inositol 3-dehydrogenase OS=Bacillus subtilis (strain 168) OX=224308 GN=iolG PE=1 SV=2
B5Y2S5	3.53e-06	25	270	3	195	Inositol 2-dehydrogenase OS=Klebsiella pneumoniae (strain 342) OX=507522 GN=iolG PE=3 SV=1
A6THJ2	4.69e-06	25	270	3	195	Inositol 2-dehydrogenase OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) OX=272620 GN=iolG PE=3 SV=2
O42896	9.15e-06	100	223	60	183	Uncharacterized oxidoreductase C115.03 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC115.03 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000032	0.000019	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003536_01344.