CAZyme Information: MGYG000003539_00468

Basic Information

• Species: Alistipes sp900769405
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Rikenellaceae; Alistipes; Alistipes sp900769405
• CAZyme ID: MGYG000003539_00468
• CAZy Family: GH18
• CAZyme Description: Chitinase A1

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
343		38482.51	5.0022

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003539	1698528	MAG	Fiji	Oceania

• Gene Location: Start: 48807; End: 49838 Strand: -

Full Sequence      

MRKIFLFLFISLVAASCTAEQKVAEEASANKILVAYVTSWSDREVDPQYLTHINYAFGHV
DSTFDRVRVDNPQRLKSIVALKKSHPHLKVLLSIGGWGSGNFSEMASDSALRWSFAQDCA
AKVSEFGLDGIDIDWEYPTTGVAKISFSENDTENYTLMMRDIRAAIGEDKLLTQATAATA
QYIDFPAVEPYVNHTNVMAYDLGWAPFHNSPLYPTEHMEKICVDDAVKLHLAAGVPPEKM
VLGLAFYGRGKKGFPRQRDLTQAHLVEGDYTFCWDPNGQVPYIVDENGELVFGYENESSL
ALKAEYILQQGLKGGMYWSYEGDNAEGDLRRCVFKVMNRQRGE

Enzyme Prediction     

No EC number prediction in MGYG000003539_00468.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH18	31	328	1.1e-67	0.9527027027027027

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06548	GH18_chitinase	8.77e-98	34	323	2	322	The GH18 (glycosyl hydrolases, family 18) type II chitinases hydrolyze chitin, an abundant polymer of N-acetylglucosamine and have been identified in bacteria, fungi, insects, plants, viruses, and protozoan parasites. The structure of this domain is an eight-stranded alpha/beta barrel with a pronounced active-site cleft at the C-terminal end of the beta-barrel.
smart00636	Glyco_18	7.95e-79	33	323	2	334	Glyco_18 domain.
pfam00704	Glyco_hydro_18	1.92e-78	33	323	2	307	Glycosyl hydrolases family 18.
cd02872	GH18_chitolectin_chitotriosidase	7.10e-73	33	323	1	341	This conserved domain family includes a large number of catalytically inactive chitinase-like lectins (chitolectins) including YKL-39, YKL-40 (HCGP39), YM1, oviductin, and AMCase (acidic mammalian chitinase), as well as catalytically active chitotriosidases. The conserved domain is an eight-stranded alpha/beta barrel fold belonging to the family 18 glycosyl hydrolases. The fold has a pronounced active-site cleft at the C-terminal end of the beta-barrel. The chitolectins lack a key active site glutamate (the proton donor required for hydrolytic activity) but retain highly conserved residues involved in oligosaccharide binding. Chitotriosidase is a chitinolytic enzyme expressed in maturing macrophages, which suggests that it plays a part in antimicrobial defense. Chitotriosidase hydrolyzes chitotriose, as well as colloidal chitin to yield chitobiose and is therefore considered an exochitinase. Chitotriosidase occurs in two major forms, the large form being converted to the small form by either RNA or post-translational processing. Although the small form, containing the chitinase domain alone, is sufficient for the chitinolytic activity, the additional C-terminal chitin-binding domain of the large form plays a role in processing colloidal chitin. The chitotriosidase gene is nonessential in humans, as about 35% of the population are heterozygous and 6% homozygous for an inactivated form of the gene. HCGP39 is a 39-kDa human cartilage glycoprotein thought to play a role in connective tissue remodeling and defense against pathogens.
COG3325	ChiA	1.07e-56	11	323	16	423	Chitinase, GH18 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT90190.1	4.10e-128	1	333	1	336
ALJ58703.1	1.64e-127	1	333	1	336
QMI79098.1	5.44e-126	1	333	1	337
ADV45176.1	5.95e-126	1	341	1	343
QUT64703.1	1.09e-125	16	333	20	337

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6INX_A	2.56e-55	28	325	2	331	Structuralinsights into a novel glycoside hydrolase family 18 N-acetylglucosaminidase from Paenibacillus barengoltzii [Paenibacillus barengoltzii]
6TSB_AAA	3.58e-49	30	325	35	339	ChainAAA, Peroxiredoxin [Clostridioides difficile 630]
6T9M_AAA	5.58e-49	30	325	54	358	ChainAAA, Peroxiredoxin [Clostridioides difficile 630]
5GZU_A	3.08e-47	33	342	28	396	CrystalStructure of Chitinase ChiW from Paenibacillus sp. str. FPU-7 Reveals a Novel Type of Bacterial Cell-Surface-Expressed Multi-Modular Enzyme Machinery [Paenibacillus sp. FPU-7],5GZU_B Crystal Structure of Chitinase ChiW from Paenibacillus sp. str. FPU-7 Reveals a Novel Type of Bacterial Cell-Surface-Expressed Multi-Modular Enzyme Machinery [Paenibacillus sp. FPU-7],5GZV_A Crystal Structure of Chitinase ChiW from Paenibacillus sp. str. FPU-7 Reveals a Novel Type of Bacterial Cell-Surface-Expressed Multi-Modular Enzyme Machinery [Paenibacillus sp. FPU-7],5GZV_B Crystal Structure of Chitinase ChiW from Paenibacillus sp. str. FPU-7 Reveals a Novel Type of Bacterial Cell-Surface-Expressed Multi-Modular Enzyme Machinery [Paenibacillus sp. FPU-7]
5GZT_B	4.15e-47	33	342	279	647	CrystalStructure of Chitinase ChiW from Paenibacillus sp. str. FPU-7 Reveals a Novel Type of Bacterial Cell-Surface-Expressed Multi-Modular Enzyme Machinery [Paenibacillus sp. FPU-7]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P20533	1.47e-38	6	323	20	438	Chitinase A1 OS=Niallia circulans OX=1397 GN=chiA1 PE=1 SV=1
Q9W092	1.74e-37	3	330	13	396	Probable chitinase 2 OS=Drosophila melanogaster OX=7227 GN=Cht2 PE=1 SV=1
Q11174	3.08e-32	18	342	40	425	Probable endochitinase OS=Caenorhabditis elegans OX=6239 GN=cht-1 PE=1 SV=1
P36362	1.86e-31	24	339	16	393	Endochitinase OS=Manduca sexta OX=7130 PE=2 SV=1
Q13231	5.46e-31	33	327	24	367	Chitotriosidase-1 OS=Homo sapiens OX=9606 GN=CHIT1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000213	0.189358	0.810183	0.000080	0.000091	0.000079

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003539_00468.