CAZyme Information: MGYG000003539_00497

Basic Information

• Species: Alistipes sp900769405
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Rikenellaceae; Alistipes; Alistipes sp900769405
• CAZyme ID: MGYG000003539_00497
• CAZy Family: GT19
• CAZyme Description: Lipid-A-disaccharide synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
379		43322.1	8.0164

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003539	1698528	MAG	Fiji	Oceania

• Gene Location: Start: 10316; End: 11455 Strand: -

Full Sequence      

MKYYLIAGEPSGDLHGSKLIAGLRKADPQAEFRFWGGDLMAAEGGKEGLAKHYRETSFFG
LMTVLRNLRTIGRQFEECRADIERFAPDVLILIDYPGFNMKMAKWAKERGLRTFYYIAPK
VWAWKEWRVKKLQRYVDRLFTIFPFETDYFRAKGIEPTFCGNPLVDDIEARRATFCSREE
FIRRNNLDNRPIIALLAGSRKSEIRENLPSMVELSKRMPEYQFVVTAVPWIDKHFYWAYM
ADGQHASDVRYVCDQTQQTLSVAEAAVVTSGTATLETALMRIPEMVVYHVPKLYEVLRPL
VLKIPFVSLVNINLGREAVREMVCAKLDLAEAERELRAIVSGGEKRTKMLSDFDQLGELI
GGAGASERFAEAMISAIQD

Enzyme Prediction     

No EC number prediction in MGYG000003539_00497.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT19	4	358	8.2e-102	0.9830508474576272

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00025	lpxB	3.42e-92	1	378	2	376	lipid-A-disaccharide synthase; Reviewed
COG0763	LpxB	2.70e-89	1	372	2	374	Lipid A disaccharide synthetase [Cell wall/membrane/envelope biogenesis].
pfam02684	LpxB	4.94e-68	4	360	2	362	Lipid-A-disaccharide synthetase. This is a family of lipid-A-disaccharide synthetases, EC:2.4.2.128. These enzymes catalyze the reaction: UDP-2,3-bis(3-hydroxytetradecanoyl) glucosamine + 2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate <=> UDP + 2,3-bis(3-hydroxytetradecanoyl)-D-glucosaminyl-1,6 -beta-D-2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate. These enzymes catalyze the fist disaccharide step in the synthesis of lipid-A-disaccharide.
TIGR00215	lpxB	3.97e-60	5	374	10	383	lipid-A-disaccharide synthase. Lipid-A precursor biosynthesis producing lipid A disaccharide in a condensation reaction. transcribed as part of an operon including lpxA [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
PRK14089	PRK14089	2.98e-42	88	312	78	285	lipid-A-disaccharide synthase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AFL77950.1	7.59e-182	1	375	1	371
BBL11605.1	1.25e-180	1	378	1	374
BBL08813.1	1.25e-180	1	378	1	374
BBL00808.1	1.77e-180	1	378	1	374
BBL06737.1	6.70e-171	1	379	1	375

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5W8N_A	1.71e-31	5	378	11	382	LipidA Disaccharide Synthase (LpxB)-6 solubilizing mutations [Escherichia coli BL21(DE3)]
5W8S_A	1.71e-31	5	378	11	382	LipidA Disaccharide Synthase (LpxB)-7 solubilizing mutations [Escherichia coli BL21(DE3)],5W8X_A Lipid A Disaccharide Synthase (LpxB)-7 solubilizing mutations-Bound to UDP [Escherichia coli BL21(DE3)]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q1D393	2.29e-60	5	374	9	375	Lipid-A-disaccharide synthase OS=Myxococcus xanthus (strain DK1622) OX=246197 GN=lpxB PE=3 SV=1
Q2LVL8	2.09e-57	5	378	8	379	Lipid-A-disaccharide synthase OS=Syntrophus aciditrophicus (strain SB) OX=56780 GN=lpxB PE=3 SV=1
B3E4H8	1.01e-53	5	378	11	381	Lipid-A-disaccharide synthase OS=Trichlorobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ) OX=398767 GN=lpxB PE=3 SV=1
Q39T49	1.46e-53	5	370	11	373	Lipid-A-disaccharide synthase OS=Geobacter metallireducens (strain ATCC 53774 / DSM 7210 / GS-15) OX=269799 GN=lpxB PE=3 SV=1
Q1INL4	3.84e-53	1	378	2	379	Lipid-A-disaccharide synthase OS=Koribacter versatilis (strain Ellin345) OX=204669 GN=lpxB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000052	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003539_00497.