CAZyme Information: MGYG000003540_01163

Basic Information

• Species: UBA1232 sp900769385
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; UBA932; UBA1232; UBA1232 sp900769385
• CAZyme ID: MGYG000003540_01163
• CAZy Family: GH18
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
325		36211.9	9.6126

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003540	1938484	MAG	Fiji	Oceania

• Gene Location: Start: 7404; End: 8381 Strand: +

Full Sequence      

MYMYKNIISSLYFALLLCLVQVLPVKNVYGRSIADVKDNGNVVLAYVTSWSSVMPNPQVL
THINYAFGHVDSTFAGVKVDNPRRLEAISALKKKHPHLKVMLSVGGWGSGRFSEMAADPQ
MREKFAKDCRRVVRKYNLDGIDIDWEYPTVSAAGISASENDIENFALLMRDIRKAVGKKK
LLTLATVCNAKYIDFPAIMPYVDFVNIMAYDMTMNIAKHHSPLFVSENTSELSAANSIEA
HLAAGVPPHKLVLGVPFYGRGNEEFRKSASYSRMPALPEGFQEKWDEKAQSSYIANAKGE
FVFGYETPRSLAVKANMPKRKALGV

Enzyme Prediction     

No EC number prediction in MGYG000003540_01163.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH18	42	324	1.5e-65	0.8986486486486487

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06548	GH18_chitinase	6.50e-99	43	324	1	312	The GH18 (glycosyl hydrolases, family 18) type II chitinases hydrolyze chitin, an abundant polymer of N-acetylglucosamine and have been identified in bacteria, fungi, insects, plants, viruses, and protozoan parasites. The structure of this domain is an eight-stranded alpha/beta barrel with a pronounced active-site cleft at the C-terminal end of the beta-barrel.
smart00636	Glyco_18	1.51e-81	42	324	1	324	Glyco_18 domain.
pfam00704	Glyco_hydro_18	2.11e-78	42	324	1	297	Glycosyl hydrolases family 18.
cd02872	GH18_chitolectin_chitotriosidase	1.75e-66	43	324	1	331	This conserved domain family includes a large number of catalytically inactive chitinase-like lectins (chitolectins) including YKL-39, YKL-40 (HCGP39), YM1, oviductin, and AMCase (acidic mammalian chitinase), as well as catalytically active chitotriosidases. The conserved domain is an eight-stranded alpha/beta barrel fold belonging to the family 18 glycosyl hydrolases. The fold has a pronounced active-site cleft at the C-terminal end of the beta-barrel. The chitolectins lack a key active site glutamate (the proton donor required for hydrolytic activity) but retain highly conserved residues involved in oligosaccharide binding. Chitotriosidase is a chitinolytic enzyme expressed in maturing macrophages, which suggests that it plays a part in antimicrobial defense. Chitotriosidase hydrolyzes chitotriose, as well as colloidal chitin to yield chitobiose and is therefore considered an exochitinase. Chitotriosidase occurs in two major forms, the large form being converted to the small form by either RNA or post-translational processing. Although the small form, containing the chitinase domain alone, is sufficient for the chitinolytic activity, the additional C-terminal chitin-binding domain of the large form plays a role in processing colloidal chitin. The chitotriosidase gene is nonessential in humans, as about 35% of the population are heterozygous and 6% homozygous for an inactivated form of the gene. HCGP39 is a 39-kDa human cartilage glycoprotein thought to play a role in connective tissue remodeling and defense against pathogens.
COG3325	ChiA	2.00e-60	42	324	39	413	Chitinase, GH18 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QQT60034.1	5.95e-100	5	323	6	316
QQT47383.1	5.95e-100	5	323	6	316
QQT54090.1	2.39e-99	39	323	33	316
QQT29942.1	4.80e-99	5	323	6	316
QRY59261.1	9.64e-99	39	316	33	309

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6KST_A	6.18e-37	43	324	9	347	Crystalstructure of the catalytic domain of chitinase ChiL from Chitiniphilus shinanonensis (CsChiL) [Chitiniphilus shinanonensis],6KST_B Crystal structure of the catalytic domain of chitinase ChiL from Chitiniphilus shinanonensis (CsChiL) [Chitiniphilus shinanonensis],6KXL_A Crystal structure of the catalytic domain of Chitiniphilus shinanonensis chitinase ChiL (CsChiL) complexed with N,N'-diacetylchitobiose [Chitiniphilus shinanonensis],6KXL_B Crystal structure of the catalytic domain of Chitiniphilus shinanonensis chitinase ChiL (CsChiL) complexed with N,N'-diacetylchitobiose [Chitiniphilus shinanonensis]
6KXM_A	3.25e-36	43	324	9	347	Crystalstructure of D157N mutant of Chitiniphilus shinanonensis chitinase ChiL (CsChiL) complexed with N,N'-diacetylchitobiose [Chitiniphilus shinanonensis],6KXM_B Crystal structure of D157N mutant of Chitiniphilus shinanonensis chitinase ChiL (CsChiL) complexed with N,N'-diacetylchitobiose [Chitiniphilus shinanonensis]
6TSB_AAA	1.12e-35	34	324	29	327	ChainAAA, Peroxiredoxin [Clostridioides difficile 630]
6KXN_A	1.23e-35	60	324	33	347	Crystalstructure of W50A mutant of Chitiniphilus shinanonensis chitinase ChiL (CsChiL) complexed with N,N'-diacetylchitobiose [Chitiniphilus shinanonensis],6KXN_B Crystal structure of W50A mutant of Chitiniphilus shinanonensis chitinase ChiL (CsChiL) complexed with N,N'-diacetylchitobiose [Chitiniphilus shinanonensis]
6T9M_AAA	1.58e-35	34	324	48	346	ChainAAA, Peroxiredoxin [Clostridioides difficile 630]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9W092	3.84e-29	42	260	42	285	Probable chitinase 2 OS=Drosophila melanogaster OX=7227 GN=Cht2 PE=1 SV=1
P20533	4.86e-28	73	324	128	428	Chitinase A1 OS=Niallia circulans OX=1397 GN=chiA1 PE=1 SV=1
P36362	6.34e-21	43	321	25	362	Endochitinase OS=Manduca sexta OX=7130 PE=2 SV=1
Q13231	3.30e-19	43	324	24	353	Chitotriosidase-1 OS=Homo sapiens OX=9606 GN=CHIT1 PE=1 SV=1
Q9D7Q1	8.13e-19	43	260	24	269	Chitotriosidase-1 OS=Mus musculus OX=10090 GN=Chit1 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000281	0.999149	0.000140	0.000137	0.000121	0.000125

TMHMM  Annotations     

start	end
7	25