CAZyme Information: MGYG000003544_00407

Basic Information

• Species: Alistipes sp900769525
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Rikenellaceae; Alistipes; Alistipes sp900769525
• CAZyme ID: MGYG000003544_00407
• CAZy Family: GH109
• CAZyme Description: Glycosyl hydrolase family 109 protein 1

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
556		62384.62	5.9834

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003544	1583718	MAG	Fiji	Oceania

• Gene Location: Start: 14693; End: 16363 Strand: -

Full Sequence      

MKLRKILAIIAVVAAALSTTITQAQSLSASTKWHWDGGTIVVDTPERAAGQQHALNLAVA
PIKNLRVAFVGLGMRGPWAVWRFSAIPGVEIVALCDYEYERAEECQKYLREQGLMSADIY
YGEQGYKAICERNDIDLIYIATDWNHHFPIAQYAMECGKHAAIEVPSAMNLEQCWTLIDL
AEQRRLHCFILENCCYDYFEMTALNIAQNGLLGEIVRAEGAYIHTLDAYWDSYWKDPEDN
DTHDLHWRLKYNMENRGDLYATHGLGPVAQCMNIHRGDRFTTLVAMDTESFIGKELVEGK
TGEACAEFRNGDHTTTLMRTARGKVVEIQHNVMTPQPYNRLFKLTGTKGYATKYPTPELA
LTSEALKGSKAPQMDDLNGHSFMTHDQRDAVLQSYYHPILAKFGEKGRDMGHGGMDYIMD
ARLVYCLQNGLPLDMDVYDMAEWCCLAELGALSMDNNCAAVAFPDFTRGHWNDNAGYSHA
YAENEQISEAIAAAYTAAQRSVTEQYKLWALYDALKTARNSNDAKAIAKAQKRLDAAKTS
AREAMHKQVSATTSNR

Enzyme Prediction     

No EC number prediction in MGYG000003544_00407.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH109	62	473	3.1e-147	0.9899749373433584

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG0673	MviM	4.65e-18	63	249	2	191	Predicted dehydrogenase [General function prediction only].
pfam01408	GFO_IDH_MocA	1.01e-09	65	190	1	118	Oxidoreductase family, NAD-binding Rossmann fold. This family of enzymes utilize NADP or NAD. This family is called the GFO/IDH/MOCA family in swiss-prot.
PRK11579	PRK11579	1.55e-08	134	219	64	149	putative oxidoreductase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ABR38645.1	8.09e-290	1	549	1	544
QQY38775.1	8.09e-290	1	549	1	544
QFQ13386.1	5.66e-243	1	516	1	519
QCQ31109.1	4.64e-239	24	510	27	512
QRO24012.1	5.51e-237	23	510	25	512

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6T2B_A	3.88e-74	47	471	25	438	Glycosidehydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila],6T2B_B Glycoside hydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila],6T2B_C Glycoside hydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila],6T2B_D Glycoside hydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila]
2IXA_A	5.07e-63	63	473	19	433	A-zyme,N-acetylgalactosaminidase [Elizabethkingia meningoseptica],2IXB_A Crystal structure of N-ACETYLGALACTOSAMINIDASE in complex with GalNAC [Elizabethkingia meningoseptica]
3FHL_A	8.22e-09	97	236	31	167	Crystalstructure of a putative oxidoreductase from bacteroides fragilis nctc 9343 [Bacteroides fragilis NCTC 9343],3FHL_B Crystal structure of a putative oxidoreductase from bacteroides fragilis nctc 9343 [Bacteroides fragilis NCTC 9343],3FHL_C Crystal structure of a putative oxidoreductase from bacteroides fragilis nctc 9343 [Bacteroides fragilis NCTC 9343],3FHL_D Crystal structure of a putative oxidoreductase from bacteroides fragilis nctc 9343 [Bacteroides fragilis NCTC 9343]
7BVJ_A	2.10e-08	64	186	3	112	UDP-N-acetylglucosamine3-dehydrogenase GnnA from Acidithiobacillus ferrooxidans (P21) [Acidithiobacillus ferrooxidans ATCC 23270],7BVJ_B UDP-N-acetylglucosamine 3-dehydrogenase GnnA from Acidithiobacillus ferrooxidans (P21) [Acidithiobacillus ferrooxidans ATCC 23270],7BVJ_C UDP-N-acetylglucosamine 3-dehydrogenase GnnA from Acidithiobacillus ferrooxidans (P21) [Acidithiobacillus ferrooxidans ATCC 23270],7BVJ_D UDP-N-acetylglucosamine 3-dehydrogenase GnnA from Acidithiobacillus ferrooxidans (P21) [Acidithiobacillus ferrooxidans ATCC 23270],7BVK_A UDP-N-acetylglucosamine 3-dehydrogenase GnnA from Acidithiobacillus ferrooxidans (P212121) [Acidithiobacillus ferrooxidans ATCC 23270],7BVK_B UDP-N-acetylglucosamine 3-dehydrogenase GnnA from Acidithiobacillus ferrooxidans (P212121) [Acidithiobacillus ferrooxidans ATCC 23270]
6A3F_A	7.01e-08	62	349	21	304	Levoglucosandehydrogenase, apo form [Pseudarthrobacter phenanthrenivorans Sphe3],6A3F_B Levoglucosan dehydrogenase, apo form [Pseudarthrobacter phenanthrenivorans Sphe3],6A3G_A Levoglucosan dehydrogenase, complex with NADH [Pseudarthrobacter phenanthrenivorans Sphe3],6A3G_B Levoglucosan dehydrogenase, complex with NADH [Pseudarthrobacter phenanthrenivorans Sphe3],6A3G_C Levoglucosan dehydrogenase, complex with NADH [Pseudarthrobacter phenanthrenivorans Sphe3],6A3G_D Levoglucosan dehydrogenase, complex with NADH [Pseudarthrobacter phenanthrenivorans Sphe3],6A3I_A Levoglucosan dehydrogenase, complex with NADH and levoglucosan [Pseudarthrobacter phenanthrenivorans Sphe3],6A3I_B Levoglucosan dehydrogenase, complex with NADH and levoglucosan [Pseudarthrobacter phenanthrenivorans Sphe3],6A3I_C Levoglucosan dehydrogenase, complex with NADH and levoglucosan [Pseudarthrobacter phenanthrenivorans Sphe3],6A3I_D Levoglucosan dehydrogenase, complex with NADH and levoglucosan [Pseudarthrobacter phenanthrenivorans Sphe3],6A3J_A Levoglucosan dehydrogenase, complex with NADH and L-sorbose [Pseudarthrobacter phenanthrenivorans Sphe3],6A3J_B Levoglucosan dehydrogenase, complex with NADH and L-sorbose [Pseudarthrobacter phenanthrenivorans Sphe3],6A3J_C Levoglucosan dehydrogenase, complex with NADH and L-sorbose [Pseudarthrobacter phenanthrenivorans Sphe3],6A3J_D Levoglucosan dehydrogenase, complex with NADH and L-sorbose [Pseudarthrobacter phenanthrenivorans Sphe3]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A6KYY1	1.62e-290	1	549	1	544	Glycosyl hydrolase family 109 protein 3 OS=Phocaeicola vulgatus (strain ATCC 8482 / DSM 1447 / JCM 5826 / CCUG 4940 / NBRC 14291 / NCTC 11154) OX=435590 GN=BVU_0950 PE=3 SV=1
A6L1Z2	1.57e-231	22	497	25	501	Glycosyl hydrolase family 109 protein 5 OS=Phocaeicola vulgatus (strain ATCC 8482 / DSM 1447 / JCM 5826 / CCUG 4940 / NBRC 14291 / NCTC 11154) OX=435590 GN=BVU_2041 PE=3 SV=1
A6KWM1	2.63e-224	12	497	14	500	Glycosyl hydrolase family 109 protein 4 OS=Phocaeicola vulgatus (strain ATCC 8482 / DSM 1447 / JCM 5826 / CCUG 4940 / NBRC 14291 / NCTC 11154) OX=435590 GN=BVU_0105 PE=3 SV=1
A6KX96	1.87e-173	42	483	38	471	Glycosyl hydrolase family 109 protein 1 OS=Phocaeicola vulgatus (strain ATCC 8482 / DSM 1447 / JCM 5826 / CCUG 4940 / NBRC 14291 / NCTC 11154) OX=435590 GN=BVU_0340 PE=3 SV=1
Q7MWF4	9.65e-173	40	483	33	468	Glycosyl hydrolase family 109 protein OS=Porphyromonas gingivalis (strain ATCC BAA-308 / W83) OX=242619 GN=PG_0664 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000334	0.998858	0.000206	0.000218	0.000193	0.000166

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003544_00407.