CAZyme Information: MGYG000003544_00879

Basic Information

• Species: Alistipes sp900769525
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Rikenellaceae; Alistipes; Alistipes sp900769525
• CAZyme ID: MGYG000003544_00879
• CAZy Family: GH53
• CAZyme Description: Arabinogalactan endo-beta-1,4-galactanase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
322	MGYG000003544_115|CGC1	36311.96	4.6143

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003544	1583718	MAG	Fiji	Oceania

• Gene Location: Start: 6357; End: 7325 Strand: -

Full Sequence      

MRSIALWLVALLSLSMAVAQSGTERPYAVGADISWLQWQEAMGVEFSDGGVKGDALDILR
DNGFNYIRLRLFVNPRSELGYSQRDGYCDLEHTLAMAKRIKEAGMYFLLDFHYSDNWADP
QKQIMPQAWQTFSYDEVCAEVYNHTKTTLEALVAQGTAPDMVQVGNEVSNGMLWPYGSVR
HSFEGLCGLLKQGVRAVREVTPEAEVMLHVALGGQAEESVRFFDAMAEYGVEYDLIGQSY
YPEWHGTLEELEANTKALVERYRKPLIVVEYRDHYLAIERIVSSLPNGFGRGTFIWEATS
PDWGKLFDRSGAATAALDNYNR

Enzyme Prediction     

No EC number prediction in MGYG000003544_00879.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH53	29	272	3.9e-96	0.716374269005848

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07745	Glyco_hydro_53	3.01e-100	28	318	1	331	Glycosyl hydrolase family 53. This domain belongs to family 53 of the glycosyl hydrolase classification. These enzymes are enzymes are endo-1,4- beta-galactanases (EC:3.2.1.89). The structure of this domain is known and has a TIM barrel fold.
COG3867	GanB	3.85e-94	4	320	6	361	Arabinogalactan endo-1,4-beta-galactosidase [Carbohydrate transport and metabolism].
cd02932	OYE_YqiM_FMN	0.002	176	236	196	258	Old yellow enzyme (OYE) YqjM-like FMN binding domain. YqjM is involved in the oxidative stress response of Bacillus subtilis. Like the other OYE members, each monomer of YqjM contains FMN as a non-covalently bound cofactor and uses NADPH as a reducing agent. The YqjM enzyme exists as a homotetramer that is assembled as a dimer of catalytically dependent dimers, while other OYE members exist only as monomers or dimers. Moreover, the protein displays a shared active site architecture where an arginine finger at the COOH terminus of one monomer extends into the active site of the adjacent monomer and is directly involved in substrate recognition. Another remarkable difference in the binding of the ligand in YqjM is represented by the contribution of the NH2-terminal tyrosine instead of a COOH-terminal tyrosine in OYE and its homologs.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AII65942.1	1.35e-108	24	320	345	639
ARN77257.1	1.87e-106	18	322	203	505
QKG56411.1	5.12e-104	11	321	11	328
QDH79868.1	7.28e-104	25	320	356	650
QJX48698.1	3.97e-103	13	321	47	359

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7OSK_A	1.39e-61	22	270	45	292	ChainA, Arabinogalactan endo-1,4-beta-galactosidase [Ignisphaera aggregans DSM 17230],7OSK_B Chain B, Arabinogalactan endo-1,4-beta-galactosidase [Ignisphaera aggregans DSM 17230]
6GPA_A	1.67e-55	24	320	4	313	Beta-1,4-galactanasefrom Bacteroides thetaiotaomicron with galactose [Bacteroides thetaiotaomicron VPI-5482],6GPA_B Beta-1,4-galactanase from Bacteroides thetaiotaomicron with galactose [Bacteroides thetaiotaomicron VPI-5482]
6GP5_A	4.59e-55	24	320	40	349	Beta-1,4-galactanasefrom Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],6GP5_B Beta-1,4-galactanase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]
1R8L_A	7.95e-43	21	277	18	270	Thestructure of endo-beta-1,4-galactanase from Bacillus licheniformis [Bacillus licheniformis],1R8L_B The structure of endo-beta-1,4-galactanase from Bacillus licheniformis [Bacillus licheniformis],1UR0_A The structure of endo-beta-1,4-galactanase from Bacillus licheniformis in complex with two oligosaccharide products. [Bacillus licheniformis],1UR0_B The structure of endo-beta-1,4-galactanase from Bacillus licheniformis in complex with two oligosaccharide products. [Bacillus licheniformis],1UR4_A The structure of endo-beta-1,4-galactanase from Bacillus licheniformis in complex with two oligosaccharide products. [Bacillus licheniformis],1UR4_B The structure of endo-beta-1,4-galactanase from Bacillus licheniformis in complex with two oligosaccharide products. [Bacillus licheniformis],2CCR_A Structure of Beta-1,4-Galactanase [Bacillus licheniformis],2CCR_B Structure of Beta-1,4-Galactanase [Bacillus licheniformis],2J74_A Structure of Beta-1,4-Galactanase [Bacillus licheniformis],2J74_B Structure of Beta-1,4-Galactanase [Bacillus licheniformis]
2GFT_A	5.92e-42	21	277	18	270	ChainA, Glycosyl Hydrolase Family 53 [Bacillus licheniformis],2GFT_B Chain B, Glycosyl Hydrolase Family 53 [Bacillus licheniformis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P48843	2.81e-67	24	303	3	312	Uncharacterized protein in bgaB 5'region (Fragment) OS=Niallia circulans OX=1397 PE=3 SV=1
O07013	1.90e-44	22	318	48	331	Endo-beta-1,4-galactanase OS=Bacillus subtilis (strain 168) OX=224308 GN=ganB PE=1 SV=1
Q0CTQ7	3.64e-44	30	270	20	261	Probable arabinogalactan endo-beta-1,4-galactanase A OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=galA PE=3 SV=1
A1D3T4	3.43e-42	30	270	27	268	Probable arabinogalactan endo-beta-1,4-galactanase A OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=galA PE=3 SV=1
Q65CX5	7.08e-42	21	277	43	295	Endo-beta-1,4-galactanase OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46) OX=279010 GN=ganB PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000244	0.999085	0.000172	0.000175	0.000161	0.000152

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003544_00879.