CAZyme Information: MGYG000003546_00967

Basic Information

• Species: UBA1181 sp900769555
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Paludibacteraceae; UBA1181; UBA1181 sp900769555
• CAZyme ID: MGYG000003546_00967
• CAZy Family: PL11
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
815		89888.81	4.4844

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003546	3032937	MAG	Fiji	Oceania

• Gene Location: Start: 43068; End: 45515 Strand: +

Full Sequence      

MKNFCYLLSLFFLVATPFYSFAADKSRALWPCKYGNRVYVSWRMRASDNPKSTVYKLFAD
GKEVASLSDKTNVSLSSEYANSIFSLEVYDRSGNLLDSQSDVRCNPDFFTHIKLDVPAAY
SMNNSEVTYSPNDCSAYDMDGDGEQEIILSWAPSNAGATCTATAPPILDCYKLDGTRLWR
INFGPNVLAGCRFTFLCYDFDGDGIGELIGKTAQGSKDATGAFLQKGAAQGANHYASSVN
SSGVITDGGREWITCFDGATGKELQTIDYWPYFNIQSDWDDRANATDGSSYGHRGNWFKG
CVAFLDVNGIPTPCAVTTRGIYTYSYAAAYHWDGKDLKVLWKHSSDRAGQGIYGQGAHSV
TCGDVDGDGFDEIIVGGAALDHDGSFLWSTGLGHGDATHLGEFDPENDGLEYLMVTEEPT
AKYDCAMFDAKTGRVLVSKAQTGGDTGRGLILDCDDRYPGSEFMEWSDANLFTCKGDVIA
PWHVGTIKNSSINFRLFWDGDLYEEYLDRGHIDKWNSQTNSWDRTLTLYSHGFGANDINS
TKYNPNLVCDLVGDWREEAVFWAQNSGNTYLTIFTSTVESQYKLPWLRDDHTYDMAITWQ
NCGYNQPPHLGYSPIVYYRELERVLPEATLTKHGAGSSSQEIMKDSAIVDFYYTWENAET
VTVTGLPNGINYTVDQSSRNVYFSGWANDVPGEYKFMVTTVGNDKNAVKSGTIIILPAEL
NGEETGVTLNRSSGVNVLIAPNPTVGEFNVLFNGVSGVVDWEISSLEGRVLSKGSWNLSG
NNSLFVIKNEGLKKGAYILTMNGNGCIVQEIMLVK

Enzyme Prediction     

No EC number prediction in MGYG000003546_00967.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL11	27	612	1.6e-159	0.9588336192109777

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd10318	RGL11	1.87e-174	26	612	5	564	Rhamnogalacturonan lyase of the polysaccharide lyase family 11. The rhamnogalacturonan lyase of the polysaccharide lyase family 11 (RGL11) cleaves glycoside bonds in polygalacturonan as well as RG (rhamnogalacturonan) type-I through a beta-elimination reaction. Functionally characterized members of this family, YesW and YesX from Bacillus subtilis, cleave glycoside bonds between rhamnose and galacturonic acid residues in the RG-I region of plant cell wall pectin. YesW and YesX work synergistically, with YesW cleaving the glycoside bond of the RG chain endolytically, and YesX converting the resultant oligosaccharides through an exotype reaction. This domain is sometimes found in architectures with non-catalytic carbohydrate-binding modules (CBMs). There are two types of RG lyases, which both cleave the alpha-1,4 bonds of the RG-I main chain through a beta-elimination reaction, but belong to two structurally unrelated polysaccharide lyase (PL) families, 4 and 11.
TIGR04183	Por_Secre_tail	9.87e-07	739	805	1	62	Por secretion system C-terminal sorting domain. Species that include Porphyromonas gingivalis, Fibrobacter succinogenes, Flavobacterium johnsoniae, Cytophaga hutchinsonii, Gramella forsetii, Prevotella intermedia, and Salinibacter ruber average twenty or more copies of a C-terminal domain, represented by this model, associated with sorting to the outer membrane and covalent modification.
pfam18962	Por_Secre_tail	3.02e-04	739	805	1	63	Secretion system C-terminal sorting domain. Species that include Porphyromonas gingivalis, Fibrobacter succinogenes, Flavobacterium johnsoniae, Cytophaga hutchinsonii, Gramella forsetii, Prevotella intermedia, and Salinibacter ruber have on average twenty or more copies of this C-terminal domain, associated with sorting to the outer membrane and covalent modification. This domain targets proteins to type IX secretion systems and is secreted then cleaved off by a C-terminal signal peptidease. Based on similarity to other families it is likely that this domain adopts an immunoglobulin like fold.
pfam18370	RGI_lyase	0.004	38	79	19	66	Rhamnogalacturonan I lyases beta-sheet domain. This is the beta-sheet domain found in rhamnogalacturonan (RG) lyases, which are responsible for an initial cleavage of the RG type I (RG-I) region of plant cell wall pectin. Polysaccharide lyase family 11 carrying this domain, such as YesW (EC:4.2.2.23) and YesX (EC:4.2.2.24), cleave glycoside bonds between rhamnose and galacturonic acid residues in RG-I through a beta-elimination reaction. Other family members carrying this domain are hemagglutinin A, lysine gingipain (Kgp) and Chitinase C (EC:3.2.1.14).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADL25062.1	1.12e-148	26	715	28	699
ACX75592.1	1.12e-148	26	715	28	699
QUT73808.1	9.47e-147	17	758	19	753
QCD43243.1	1.16e-138	22	782	19	751
QUT74217.1	3.28e-132	40	612	517	1085

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4CAG_A	3.79e-129	26	612	15	573	Bacilluslicheniformis Rhamnogalacturonan Lyase PL11 [Bacillus licheniformis]
2Z8R_A	7.03e-124	26	612	9	566	Crystalstructure of rhamnogalacturonan lyase YesW at 1.40 A resolution [Bacillus subtilis],2Z8R_B Crystal structure of rhamnogalacturonan lyase YesW at 1.40 A resolution [Bacillus subtilis],2Z8S_A Crystal structure of rhamnogalacturonan lyase YesW complexed with digalacturonic acid [Bacillus subtilis],2Z8S_B Crystal structure of rhamnogalacturonan lyase YesW complexed with digalacturonic acid [Bacillus subtilis],2ZUX_A Crystal structure of rhamnogalacturonan lyase YesW complexed with rhamnose [Bacillus subtilis],2ZUX_B Crystal structure of rhamnogalacturonan lyase YesW complexed with rhamnose [Bacillus subtilis]
2ZUY_A	1.94e-106	38	612	24	587	Crystalstructure of exotype rhamnogalacturonan lyase YesX [Bacillus subtilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O31526	9.02e-123	26	612	46	603	Rhamnogalacturonan endolyase YesW OS=Bacillus subtilis (strain 168) OX=224308 GN=yesW PE=1 SV=1
O31527	8.52e-106	38	612	24	587	Rhamnogalacturonan exolyase YesX OS=Bacillus subtilis (strain 168) OX=224308 GN=yesX PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000247	0.999134	0.000159	0.000147	0.000138	0.000132

TMHMM  Annotations     

start	end
5	23