CAZyme Information: MGYG000003546_01801

Basic Information

• Species: UBA1181 sp900769555
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Paludibacteraceae; UBA1181; UBA1181 sp900769555
• CAZyme ID: MGYG000003546_01801
• CAZy Family: GH73
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
315		36320.75	9.8008

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003546	3032937	MAG	Fiji	Oceania

• Gene Location: Start: 34535; End: 35482 Strand: -

Full Sequence      

MRKFVSVFVLLFAVVISLVAQSYQSAQTTAYIERYHKVAIREMYLYKIPASITLAQGILE
SGSGRSDLAIRANNHFGIKCPGDYSGKGYYKDDDKRNECFRVYKNADESFRDHSIFLTKS
RYSELFELSITDYKGWAKGLKKAGYATNSKYPQLLMEIIEQNKLYEYDKHPERYLAEKDV
TPDSRTLNVIAPNPAKKMPQNSPTPPALKRNKVNGIKCIQVKAGDTFYGISKQTGLTIAE
LKYLNEMPEDHVLQVGEYIYLEEKKKKNKEQDRHYVREGDTWYSISQLYGIRKLNLMKMN
AKHRYLIAGISLKLN

Enzyme Prediction     

No EC number prediction in MGYG000003546_01801.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH73	38	164	3.3e-31	0.96875

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1705	FlgJ	1.37e-34	3	169	6	189	Flagellum-specific peptidoglycan hydrolase FlgJ [Cell wall/membrane/envelope biogenesis, Cell motility].
NF038016	sporang_Gsm	1.19e-33	30	168	162	312	sporangiospore maturation cell wall hydrolase GsmA. The peptidoglycan-hydrolyzing enzyme GsmA occurs in some sporangia-forming members of the Actinobacteria, such as Actinoplanes missouriensis, and is required for proper separation of spores. GsmA proteins have one or two SH3 domains N-terminal to the hydrolase domain.
pfam01832	Glucosaminidase	3.47e-25	37	113	2	77	Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase. This family includes Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase EC:3.2.1.96. As well as the flageller protein J that has been shown to hydrolyze peptidoglycan.
smart00047	LYZ2	1.38e-20	18	168	3	147	Lysozyme subfamily 2. Eubacterial enzymes distantly related to eukaryotic lysozymes.
PRK08581	PRK08581	5.09e-16	25	169	317	473	amidase domain-containing protein.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AHF12398.1	1.55e-73	31	300	31	282
AEV32832.1	4.99e-73	14	300	8	275
QRO23242.1	6.60e-72	31	300	33	279
QPH38130.1	1.14e-71	22	259	44	278
QJR67483.1	1.92e-71	24	300	27	280

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3VWO_A	7.84e-08	48	164	21	148	Crystalstructure of peptidoglycan hydrolase mutant from Sphingomonas sp. A1 [Sphingomonas sp. A1]
2ZYC_A	9.06e-08	48	164	22	149	ChainA, Peptidoglycan hydrolase FlgJ [Sphingomonas sp. A1]
3K3T_A	5.68e-07	48	164	22	149	E185Amutant of peptidoglycan hydrolase from Sphingomonas sp. A1 [Sphingomonas sp. A1]
5T1Q_A	2.74e-06	48	168	80	212	ChainA, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_B Chain B, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_C Chain C, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_D Chain D, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O32083	3.90e-12	46	169	66	199	Exo-glucosaminidase LytG OS=Bacillus subtilis (strain 168) OX=224308 GN=lytG PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.019610	0.978463	0.001069	0.000258	0.000260	0.000291

TMHMM  Annotations     

start	end
5	24