CAZyme Information: MGYG000003547_00924

Basic Information

• Species: UMGS1976 sp900769535
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Acutalibacteraceae; UMGS1976; UMGS1976 sp900769535
• CAZyme ID: MGYG000003547_00924
• CAZy Family: GH36
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
572	MGYG000003547_88|CGC1	65140.17	5.8872

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003547	1366229	MAG	Fiji	Oceania

• Gene Location: Start: 8591; End: 10309 Strand: -

Full Sequence      

MKIYGGNAGAKIWIDNENENSGIKHFTVHAKLSEKQVPENFSVQFEVPHIECYSVWSPYL
SHRRQIGPDWAPSTTYANIASSMPLHSVLSVNGNNRLTLAIDDAMSPTAIKTGVREEDGN
IVVTFTFFTETTTAIEEYSATVRVDTRDIPFYDAVYDVVSWWENECGYTPLGVTEHAKLP
MNSLWYSYHQKLDTESIIKEAHLAKEMGMESIIVDDGWQTDDNSRGYAYCGDWELATTKI
PNMRELVDRVHKEGVKFILWFSVPFVGKYSKAFQKFKDMLLCDNPEAVDYTPLDPRYKKV
RDYLISIYKKHLIEWDLDGFKLDFIDSFRLKQSSIAPDSRRDYESLVEAIDRLMTDITVE
LKKIKPDIMIEFRQSYVGPAIRKYGNMLRAGDCPNDAISNRKHTLDLRLTSGNTAVHSDM
LMWNKNDTPESAMLQFTSILYSVPQISVKLDELSDLHYKALKFYLSFWRKNADILMNGKL
HVFDTAHDYSAACAVLDKKAIYTCYINTIVDGKNYDELTIVNASPKNSVIIKNCGGKSYR
AVNCFGETISEGKINSSLAEIELPLSAIILIK

Enzyme Prediction     

No EC number prediction in MGYG000003547_00924.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH36	185	503	1.2e-36	0.4752906976744186

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd14791	GH36	3.25e-68	182	470	7	299	glycosyl hydrolase family 36 (GH36). GH36 enzymes occur in prokaryotes, eukaryotes, and archaea with a wide range of hydrolytic activities, including alpha-galactosidase, alpha-N-acetylgalactosaminidase, stachyose synthase, and raffinose synthase. All GH36 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein. GH36 members are retaining enzymes that cleave their substrates via an acid/base-catalyzed, double-displacement mechanism involving a covalent glycosyl-enzyme intermediate. Two aspartic acid residues have been identified as the catalytic nucleophile and the acid/base, respectively.
cd06592	GH31_NET37	2.26e-12	180	324	3	151	glucosidase NET37. NET37 (also known as KIAA1161) is a human lamina-associated nuclear envelope transmembrane protein. A member of the glycosyl hydrolase family 31 (GH31) , it has been shown to be required for myogenic differentiation of C2C12 cells. Related proteins are found in eukaryotes and prokaryotes. Enzymes of the GH31 family possess a wide range of different hydrolytic activities including alpha-glucosidase (glucoamylase and sucrase-isomaltase), alpha-xylosidase, 6-alpha-glucosyltransferase, 3-alpha-isomaltosyltransferase and alpha-1,4-glucan lyase. All GH31 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein.
COG3345	GalA	6.26e-11	173	278	288	392	Alpha-galactosidase [Carbohydrate transport and metabolism].
COG1501	YicI	2.09e-06	182	324	270	413	Alpha-glucosidase, glycosyl hydrolase family GH31 [Carbohydrate transport and metabolism].
cd06597	GH31_transferase_CtsY	5.38e-06	195	392	24	229	CtsY (cyclic tetrasaccharide-synthesizing enzyme Y)-like. CtsY is a bacterial 3-alpha-isomaltosyltransferase, first identified in Arthrobacter globiformis, that produces cyclic tetrasaccharides together with a closely related enzyme CtsZ. CtsY and CtsZ both have a glycosyl hydrolase family 31 (GH31) catalytic domain; CtsZ belongs to a different subfamily. All GH31 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AZS17022.1	1.90e-158	4	569	12	581
QTH41069.1	3.93e-157	2	571	13	588
QMV40951.1	1.01e-155	1	554	10	566
AIQ22829.1	8.85e-155	26	569	21	571
QOV11148.1	6.47e-154	48	572	54	586

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4FNR_A	2.48e-10	185	358	336	515	Crystalstructure of GH36 alpha-galactosidase AgaA from Geobacillus stearothermophilus [Geobacillus stearothermophilus],4FNR_B Crystal structure of GH36 alpha-galactosidase AgaA from Geobacillus stearothermophilus [Geobacillus stearothermophilus],4FNR_C Crystal structure of GH36 alpha-galactosidase AgaA from Geobacillus stearothermophilus [Geobacillus stearothermophilus],4FNR_D Crystal structure of GH36 alpha-galactosidase AgaA from Geobacillus stearothermophilus [Geobacillus stearothermophilus]
2YFN_A	3.91e-09	185	323	336	485	galactosidasedomain of alpha-galactosidase-sucrose kinase, AgaSK [[Ruminococcus] gnavus E1],2YFO_A GALACTOSIDASE DOMAIN OF ALPHA-GALACTOSIDASE-SUCROSE KINASE, AGASK, in complex with galactose [[Ruminococcus] gnavus E1]
6PHU_A	2.08e-08	185	318	350	494	SpAgawild type apo structure [Streptococcus pneumoniae TIGR4],6PHV_A Chain A, Alpha-galactosidase [Streptococcus pneumoniae TIGR4]
6PHW_A	8.25e-08	185	318	350	494	ChainA, Alpha-galactosidase [Streptococcus pneumoniae TIGR4],6PHX_A SpAga D472N structure in complex with raffinose [Streptococcus pneumoniae TIGR4],6PHY_A Chain A, Alpha-galactosidase [Streptococcus pneumoniae TIGR4],6PI0_A AgaD472N-Linear Blood group B type 2 trisaccharide complex structure [Streptococcus pneumoniae TIGR4]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9ALJ4	1.36e-09	185	358	336	515	Alpha-galactosidase AgaA OS=Geobacillus stearothermophilus OX=1422 GN=agaA PE=1 SV=1
G4T4R7	2.38e-08	185	323	336	485	Bifunctional alpha-galactosidase/sucrose kinase AgaSK OS=Ruminococcus gnavus OX=33038 GN=agaSK PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000053	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003547_00924.