CAZyme Information: MGYG000003548_01074

Basic Information

• Species: QALS01 sp900769545
• Lineage: Bacteria; Firmicutes_A; Clostridia_A; Christensenellales; Borkfalkiaceae; QALS01; QALS01 sp900769545
• CAZyme ID: MGYG000003548_01074
• CAZy Family: GT5
• CAZyme Description: Glycogen synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
510		58129.4	5.556

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003548	2291640	MAG	Fiji	Oceania

• Gene Location: Start: 11554; End: 13086 Strand: +

Full Sequence      

MAENTTKTGKKITILQNNQVTFPQEVHSDDPQVVTKRKILFVASEARPFIATGGLADVIG
SLPQALASDSTYDIRVVLPLYSDIKTEFRRKMSFLGNIYIPLGWRNQYCGIFSYQDNGVT
FYFIDNEYYFKRPGCYGYYDDGERFAFFSRAVMEILPFIGFYPDILHCHDWQAALSAIYL
KTIYCKRPEYQFIRALFTIHNIEYQGKYSLDILEDLFGISNEYRYLVEYNGCINLMKGAI
ECCERFSTVSPTYAKEITSAEYAHGLEELIRRNQFKLKGILNGIDVDGYCPETDKALFAN
YSADNLDNKKVCKTELQKMLGLPIKDVPIIAMISRLVSHKVLELVKTVAEDILHEDVQFV
LLGTGEASYEEYFRDLGKRYEGKASVNIAFNGDLSRKIYSGSDIFLMPSVSEPCGLSQMI
ASRYATVPLVRETGGLYDSIKPYGAGGNGFTFASCNPYDMLYVIHEALETYKKTDEWKNL
MKTAATTDFSWARSAEEYKKLYAETFDVLK

Enzyme Prediction     

No EC number prediction in MGYG000003548_01074.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT5	38	503	5.3e-164	0.9957627118644068

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
TIGR02095	glgA	0.0	38	504	2	472	glycogen/starch synthase, ADP-glucose type. This family consists of glycogen (or starch) synthases that use ADP-glucose (EC 2.4.1.21), rather than UDP-glucose (EC 2.4.1.11) as in animals, as the glucose donor. This enzyme is found in bacteria and plants. Whether the name given is glycogen synthase or starch synthase depends on context, and therefore on substrate. [Energy metabolism, Biosynthesis and degradation of polysaccharides]
PRK00654	glgA	0.0	38	504	2	462	glycogen synthase GlgA.
cd03791	GT5_Glycogen_synthase_DULL1-like	0.0	38	504	1	474	Glycogen synthase GlgA and similar proteins. This family is most closely related to the GT5 family of glycosyltransferases. Glycogen synthase (EC:2.4.1.21) catalyzes the formation and elongation of the alpha-1,4-glucose backbone using ADP-glucose, the second and key step of glycogen biosynthesis. This family includes starch synthases of plants, such as DULL1 in Zea mays and glycogen synthases of various organisms.
COG0297	GlgA	1.15e-180	38	502	2	475	Glycogen synthase [Carbohydrate transport and metabolism].
pfam08323	Glyco_transf_5	5.93e-95	39	272	1	239	Starch synthase catalytic domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCI60006.1	1.58e-170	38	502	2	469
ASB40510.1	1.04e-168	38	507	2	474
QQR29794.1	1.04e-168	38	507	2	474
ANU52824.1	1.04e-168	38	507	2	474
QNO18264.1	1.15e-167	38	504	2	470

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3D1J_A	4.30e-86	38	502	2	473	ChainA, Glycogen synthase [Escherichia coli]
2QZS_A	7.54e-86	38	502	2	473	CrystalStructure of Wild-type E.coli GS in complex with ADP and Glucose(wtGSb) [Escherichia coli],2R4T_A Crystal Structure of Wild-type E.coli GS in Complex with ADP and Glucose(wtGSc) [Escherichia coli],2R4U_A Crystal Structure of Wild-type E.coli GS in complex with ADP and Glucose(wtGSd) [Escherichia coli],3GUH_A Crystal Structure of Wild-type E.coli GS in complex with ADP and DGM [Escherichia coli K-12]
3COP_A	5.85e-85	38	502	2	473	ChainA, Glycogen synthase [Escherichia coli],3CX4_A Chain A, Glycogen synthase [Escherichia coli]
4HLN_A	2.25e-84	28	506	116	626	Structureof barley starch synthase I in complex with maltooligosaccharide [Hordeum vulgare]
6GNE_A	3.93e-76	39	505	12	497	Catalyticdomain of Starch Synthase IV from Arabidopsis thaliana bound to ADP and acarbose [Arabidopsis thaliana],6GNE_B Catalytic domain of Starch Synthase IV from Arabidopsis thaliana bound to ADP and acarbose [Arabidopsis thaliana]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A4J4I4	2.12e-165	38	502	2	471	Glycogen synthase OS=Desulfotomaculum reducens (strain MI-1) OX=349161 GN=glgA PE=3 SV=1
A4IS20	1.02e-151	38	504	2	473	Glycogen synthase OS=Geobacillus thermodenitrificans (strain NG80-2) OX=420246 GN=glgA PE=3 SV=1
O08328	4.11e-151	38	504	2	473	Glycogen synthase OS=Geobacillus stearothermophilus OX=1422 GN=glgA PE=3 SV=1
Q6HC18	4.53e-148	39	502	3	471	Glycogen synthase OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) OX=281309 GN=glgA PE=3 SV=2
B9J2G5	1.28e-147	39	502	3	471	Glycogen synthase OS=Bacillus cereus (strain Q1) OX=361100 GN=glgA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000063	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003548_01074.