CAZyme Information: MGYG000003548_01798

Basic Information

• Species: QALS01 sp900769545
• Lineage: Bacteria; Firmicutes_A; Clostridia_A; Christensenellales; Borkfalkiaceae; QALS01; QALS01 sp900769545
• CAZyme ID: MGYG000003548_01798
• CAZy Family: GH78
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
736		84559.6	5.07

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003548	2291640	MAG	Fiji	Oceania

• Gene Location: Start: 1889; End: 4099 Strand: +

Full Sequence      

MEARWAKNQIMRNTELCFVCKLKKISSAELIFIAKDLYNLYINGQFVQYGPARAAKGYAR
EERVVLDGYLTKAENTVCVYVQSNYTKALCFAIEKPLFAAEIRCGEEVVFTTDDFRCFEM
SDKLRKVEKMSSQRGYVEVYRQQKNRQPFDMSAFLEQELIAVEMPKLLPRNVSMAKHDIA
KAELFKRGKIEVDPTQVWENDFTRLLENKEKLHSYVRSECDCVLSKEILSFVFDGGNPTE
GYRYETYTFGRTNCGKFRIKIKVATPTTLWLAYDDILIDGHVKFNREQIIHGLKWELEKG
EYLLDSNEVYTAQYLAFVIKGEAAIEEAAMIRVENPDAVEMEFSCEDKTLESIVEAARHS
FQHNGYDLLTDCPSRERAGYLCDGFFAARAETFFCGKNLVEKNLLENYALYKNEVFEHDG
ILPMCYPSEPQAKDDFIPNWVLWYVLQLEDYLLRTNDEGFVAAQKERVLGVLDYFKSKEN
EYGLLEDLDGWVFVEWSKANDFVDGVNFPSNMCYYGAIRAAAKLLNDDALALKAETLKKT
IIEKSFNGEFFADNALRENGVLKTTKNISETCQNYAAFFEIFTAQENPAFYERLIFKLGC
FHREKYYPDVHVSNMFIGYIVRLTVLLREKQYKAILAECKNRFADMADSTGTIWELFQTN
ASCNHGFGAVVGLIIACSLTGYMGVDEKTKTLYFSKEHENIDCQIKIPLKEGKAELSVTA
NERKIVAPAGYTVTIE

Enzyme Prediction     

No EC number prediction in MGYG000003548_01798.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	247	735	7.1e-46	0.9742063492063492

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	3.09e-12	342	670	5	332	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
COG3408	GDB1	0.001	383	556	288	472	Glycogen debranching enzyme (alpha-1,6-glucosidase) [Carbohydrate transport and metabolism].
pfam04685	DUF608	0.009	444	551	104	216	Glycosyl-hydrolase family 116, catalytic region. This represents a family of archaeal, bacterial and eukaryotic glycosyl hydrolases, that belong to superfamily GH116. The primary catabolic pathway for glucosylceramide is catalysis by the lysosomal enzyme glucocerebrosidase. In higher eukaryotes, glucosylceramide is the precursor of glycosphingolipids, a complex group of ubiquitous membrane lipids. Mutations in the human protein cause motor-neurone defects in hereditary spastic paraplegia. The catalytic nucleophile, identified in UniProtKB:Q97YG8_SULSO, is a glutamine-335, with the likely acid/base at Asp-442 and the aspartates at Asp-406 and Asp-458 residues also playing a role in the catalysis of glucosides and xylosides that are beta-bound to hydrophobic groups. The family is defined as GH116, which presently includes enzymes with beta-glucosidase, EC:3.2.1.21, beta-xylosidase, EC:3.2.1.37, and glucocerebrosidase EC:3.2.1.45 activity.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGY42778.1	1.97e-134	19	725	62	790
BBD46135.1	3.16e-134	26	736	78	814
QUH27875.1	1.36e-129	37	698	48	727
QDH81296.1	3.71e-129	2	736	36	801
SCM59084.1	1.11e-123	26	736	79	815

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000072	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003548_01798.