CAZyme Information: MGYG000003549_00040

Basic Information

• Species: UBA1259 sp900769565
• Lineage: Bacteria; Firmicutes_A; Clostridia_A; Christensenellales; Borkfalkiaceae; UBA1259; UBA1259 sp900769565
• CAZyme ID: MGYG000003549_00040
• CAZy Family: GH78
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
532		61942.79	4.8166

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003549	1484614	MAG	Fiji	Oceania

• Gene Location: Start: 40534; End: 42132 Strand: -

Full Sequence      

MQIKVWYYGVNNQTYITDVAGVIFNLTVDGKEVVVSNQNTLSRQDINFCNGYNKLLTLQI
GQSFKYDNTIENNLPYKNSFLVEKSRNFIERKRKNLTLGEKICGQIIKGNLVDFKKECVG
FVSLDIYSETEQTIVVSFGEYLTDKGTVLRIWEERDFSFEYVLKPGENKLFNSFRRCGLR
YIDIESEKPIKINEVAILPVNYPLTTVPYKLENDLDQRIYDTCVYTLRSCMHEHYEDCPW
REQALYSMDGFNEMRGGFYAFNEIEYARYNLMFISRGIRSDGLLSICYPTGRDIPIPSFS
LVYFRTVEEYVKFTNDRSVLPEILPVLKKIKEAFESRIDENNLIPCFEFPCWNFYEWSVG
SDREYQITRKPEDVEPRKYDLIINCMYLYAMQSYCNLTGEVIDFEPMKKAINDTFYVNGL
YKLCTDGEIYGQLGNVFAVLSGVADKSLVEKIINDKSLVPCTLSMKTFLYEAVDDKDFIL
NDIRNDYSYMLDAGATTFWETINGVKIDVAGSLCHGWSTIPIIYFNKYLNKK

Enzyme Prediction     

No EC number prediction in MGYG000003549_00040.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	111	529	2.3e-57	0.8531746031746031

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	1.24e-14	213	529	10	340	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam05592	Bac_rhamnosid	1.12e-04	111	186	9	86	Bacterial alpha-L-rhamnosidase concanavalin-like domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AUS95627.1	1.21e-72	3	527	91	706
ARN56684.1	6.80e-63	111	525	274	708
QGQ97405.1	2.50e-58	1	529	89	714
AQQ71631.1	6.77e-58	6	524	94	687
QNK57365.1	7.74e-52	111	529	268	713

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2OKX_A	1.67e-22	111	521	440	868	Crystalstructure of GH78 family rhamnosidase of Bacillus SP. GL1 AT 1.9 A [Bacillus sp. GL1],2OKX_B Crystal structure of GH78 family rhamnosidase of Bacillus SP. GL1 AT 1.9 A [Bacillus sp. GL1]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000058	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003549_00040.