CAZyme Information: MGYG000003549_01021

Basic Information

• Species: UBA1259 sp900769565
• Lineage: Bacteria; Firmicutes_A; Clostridia_A; Christensenellales; Borkfalkiaceae; UBA1259; UBA1259 sp900769565
• CAZyme ID: MGYG000003549_01021
• CAZy Family: GH32
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
369		42051.1	4.7114

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003549	1484614	MAG	Fiji	Oceania

• Gene Location: Start: 5772; End: 6881 Strand: +

Full Sequence      

MENIAIESTPDMWGVTKVEVNGETELVGSADPSNIWKANGKYYIQTGNKPILDRFGRGDK
AIEKYKGDWTDLFRSDDLKNWEYVGRFYDNPQMGVNGYPDETEDDMCPSFLPLYDAEENG
NPTDKYLQMFISHNKGCQYYIGSMDGERFVPEQHGRMSWKDSAYFAPEALVDGKNRQIVW
TWLRDNLPDDFKRFGWSGVFGLPRNVWYEDGELKQAPVAEIDKLQYGQISYSPADGDNVK
VGDGSACRIKGKWCGSEKAGVAVRISGDGKEYTEIYYSPEEKKLVMDTTHSGGEGWRVRE
EAPFELRGDEKLSLDILIDKSVIEVYANKRQAICRRVYPTDPKNSIGVKLIGKVPEKLDT
YKMFPTNPY

Enzyme Prediction     

No EC number prediction in MGYG000003549_01021.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH32	31	217	5e-22	0.552901023890785

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd08996	GH32_FFase	2.96e-33	3	207	93	280	Glycosyl hydrolase family 32, beta-fructosidases. Glycosyl hydrolase family GH32 cleaves sucrose into fructose and glucose via beta-fructofuranosidase activity, producing invert sugar that is a mixture of dextrorotatory D-glucose and levorotatory D-fructose, thus named invertase (EC 3.2.1.26). This family also contains other fructofuranosidases such as inulinase (EC 3.2.1.7), exo-inulinase (EC 3.2.1.80), levanase (EC 3.2.1.65), and transfructosidases such sucrose:sucrose 1-fructosyltransferase (EC 2.4.1.99), fructan:fructan 1-fructosyltransferase (EC 2.4.1.100), sucrose:fructan 6-fructosyltransferase (EC 2.4.1.10), fructan:fructan 6G-fructosyltransferase (EC 2.4.1.243) and levan fructosyltransferases (EC 2.4.1.-). These retaining enzymes (i.e. they retain the configuration at anomeric carbon atom of the substrate) catalyze hydrolysis in two steps involving a covalent glycosyl enzyme intermediate: an aspartate located close to the N-terminus acts as the catalytic nucleophile and a glutamate acts as the general acid/base; a conserved aspartate residue in the Arg-Asp-Pro (RDP) motif stabilizes the transition state. These enzymes are predicted to display a 5-fold beta-propeller fold as found for GH43 and CH68. The breakdown of sucrose is widely used as a carbon or energy source by bacteria, fungi, and plants. Invertase is used commercially in the confectionery industry, since fructose has a sweeter taste than sucrose and a lower tendency to crystallize. A common structural feature of all these enzymes is a 5-bladed beta-propeller domain, similar to GH43, that contains the catalytic acid and catalytic base. A long V-shaped groove, partially enclosed at one end, forms a single extended substrate-binding surface across the face of the propeller.
smart00640	Glyco_32	6.85e-33	31	329	136	436	Glycosyl hydrolases family 32.
COG1621	SacC	3.20e-27	31	346	164	466	Sucrose-6-phosphate hydrolase SacC, GH32 family [Carbohydrate transport and metabolism].
pfam08244	Glyco_hydro_32C	3.83e-18	252	350	44	146	Glycosyl hydrolases family 32 C terminal. This domain corresponds to the C terminal domain of glycosyl hydrolase family 32. It forms a beta sandwich module.
pfam00251	Glyco_hydro_32N	2.00e-16	31	217	133	308	Glycosyl hydrolases family 32 N-terminal domain. This domain corresponds to the N-terminal domain of glycosyl hydrolase family 32 which forms a five bladed beta propeller structure.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ARN56627.1	3.73e-115	3	369	398	772
AZN41469.1	1.88e-112	2	369	144	518
CDR30229.1	2.13e-80	2	369	143	506
APW62066.1	2.50e-40	58	365	406	733
AWI10009.1	3.10e-40	31	365	442	793

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6NUM_A	4.53e-27	31	353	181	498	Thestructure of GH32 from Bifidobacteium adolescentis [Bifidobacterium adolescentis],6NUN_A Structure of GH32 hydrolase from Bifidobacterium adolescentis in complex with frutose [Bifidobacterium adolescentis]
7VCO_A	2.62e-17	31	346	162	466	ChainA, Sucrose-6-phosphate hydrolase [Frischella perrara],7VCP_A Chain A, Sucrose-6-phosphate hydrolase [Frischella perrara]
1UYP_A	2.28e-16	7	349	68	416	Thethree-dimensional structure of beta-fructosidase (invertase) from Thermotoga maritima [Thermotoga maritima MSB8],1UYP_B The three-dimensional structure of beta-fructosidase (invertase) from Thermotoga maritima [Thermotoga maritima MSB8],1UYP_C The three-dimensional structure of beta-fructosidase (invertase) from Thermotoga maritima [Thermotoga maritima MSB8],1UYP_D The three-dimensional structure of beta-fructosidase (invertase) from Thermotoga maritima [Thermotoga maritima MSB8],1UYP_E The three-dimensional structure of beta-fructosidase (invertase) from Thermotoga maritima [Thermotoga maritima MSB8],1UYP_F The three-dimensional structure of beta-fructosidase (invertase) from Thermotoga maritima [Thermotoga maritima MSB8]
1W2T_A	3.06e-16	7	349	68	416	beta-fructosidasefrom Thermotoga maritima in complex with raffinose [Thermotoga maritima MSB8],1W2T_B beta-fructosidase from Thermotoga maritima in complex with raffinose [Thermotoga maritima MSB8],1W2T_C beta-fructosidase from Thermotoga maritima in complex with raffinose [Thermotoga maritima MSB8],1W2T_D beta-fructosidase from Thermotoga maritima in complex with raffinose [Thermotoga maritima MSB8],1W2T_E beta-fructosidase from Thermotoga maritima in complex with raffinose [Thermotoga maritima MSB8],1W2T_F beta-fructosidase from Thermotoga maritima in complex with raffinose [Thermotoga maritima MSB8]
6NU7_A	5.18e-09	31	328	167	451	Structureof sucrose-6-phosphate hydrolase from Lactobacillus gasseri [Lactobacillus gasseri 224-1],6NU8_A Structure of sucrose-6-phosphate hydrolase from Lactobacillus gasseri in complex with fructose [Lactobacillus gasseri 224-1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
B6DZD0	1.20e-18	72	339	229	552	Fructan 1-exohydrolase OS=Triticum urartu OX=4572 GN=1-FEH PE=3 SV=1
Q84PN8	2.16e-18	72	339	229	552	Fructan 1-exohydrolase w1 OS=Triticum aestivum OX=4565 GN=1-FEHw1 PE=1 SV=1
B6DZD1	1.68e-17	72	339	227	550	Fructan 1-exohydrolase OS=Aegilops speltoides OX=4573 GN=1-FEH PE=3 SV=1
Q84LA1	3.03e-17	72	339	228	551	Fructan 1-exohydrolase w2 OS=Triticum aestivum OX=4565 GN=1-FEHw2 PE=1 SV=1
B6DZD2	3.03e-17	72	339	228	551	Fructan 1-exohydrolase OS=Aegilops tauschii OX=37682 GN=1-FEH PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000064	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003549_01021.