CAZyme Information: MGYG000003550_02344

Basic Information

• Species: Clostridium sp900769625
• Lineage: Bacteria; Firmicutes_A; Clostridia; Clostridiales; Clostridiaceae; Clostridium; Clostridium sp900769625
• CAZyme ID: MGYG000003550_02344
• CAZy Family: GH73
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
775		85824.52	4.6631

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003550	3104477	MAG	Fiji	Oceania

• Gene Location: Start: 3080; End: 5407 Strand: -

Full Sequence      

MNIYSTIKKKFTIFIVVFTMILGLVPTLSVQAATTTDFKIISTTDVTAAQAKKWAKSNGA
TDTFADLAKIYWKYAEDCGSVNPGIAYVQAAKETGYGRFGGVLDESYKNPCGMKTSQGGG
DYEKNAHQKFNSWDEGVQAHMDHLALYAGAEGYPKRNTYDPRHFVTIKGRASTTNSLGGK
WAPNAAYGEEVGKLYISLLDYAGVEHEKEDEDDDLWEEEEDEDTSSAPNPGTVEKKPADI
VIESAIELPKKSSENVSGSAEGSDSDASGNTESGNNNSDDKPSIVSEIGWKQIDGNWYFY
KSDETKAFGWIKPDSNWYYLSEEDGRMVRGWQKYNNLWYYFDESGAMIKGWKLIDNKWYF
FNKDGVMTTGVQNDGDNSYYLNESGEMVAEEGWIKLNNKWMYLEAGGKIKFGWLKENNQY
YYLQGDGSMVTGLKKIDGQVYSFYDNGTMETGWKQIDGNWYYFRDNGAMATGWTYDGSTC
YYLYDNGAMAKGWIQVGGLWYLLNSSGAMQTGWVDSNGDTYYLDKSTGRLLTNTTVDGYK
IGNDGKRKNKVTQNNSNSSSNSNTTPSSPNSNSGSGKVIYVDAGHDYGKDYGAQTTINGV
TYSETELNMQVADKLKTALEDRGYTVVMTRNLGERPAFSSLTESLAYRVNKANSANADLF
ISIHHNSAGATAKGIETLYSEVSQDDAFGGQYDSARIDKSKSLATQINNNIANNLNLTNR
GCKSQNLYVCRNTKMPAVLVEVGFITNAEEAARCADQTSQQKVAEAIAEVVAQNY

Enzyme Prediction     

No EC number prediction in MGYG000003550_02344.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
NF033930	pneumo_PspA	1.58e-64	289	545	444	657	pneumococcal surface protein A. The pneumococcal surface protein proteins, found in Streptococcus pneumoniae, are repetitive, with patterns of localized high sequence identity across pairs of proteins given different specific names that recombination may be presumed. This protein, PspA, has an N-terminal region that lacks a cross-wall-targeting YSIRK type extended signal peptide, in contrast to the closely related choline-binding protein CbpA which has a similar C-terminus but a YSIRK-containing region at the N-terminus.
cd02696	MurNAc-LAA	2.11e-53	578	772	1	172	N-acetylmuramoyl-L-alanine amidase or MurNAc-LAA (also known as peptidoglycan aminohydrolase, NAMLA amidase, NAMLAA, Amidase 3, and peptidoglycan amidase; EC 3.5.1.28) is an autolysin that hydrolyzes the amide bond between N-acetylmuramoyl and L-amino acids in certain cell wall glycopeptides. These proteins are Zn-dependent peptidases with highly conserved residues involved in cation co-ordination. MurNAc-LAA in this family is one of several peptidoglycan hydrolases (PGHs) found in bacterial and bacteriophage or prophage genomes that are involved in the degradation of the peptidoglycan. In Escherichia coli, there are five MurNAc-LAAs present: AmiA, AmiB, AmiC and AmiD that are periplasmic, and AmpD that is cytoplasmic. Three of these (AmiA, AmiB and AmiC) belong to this family, the other two (AmiD and AmpD) do not. E. coli AmiA, AmiB and AmiC play an important role in cleaving the septum to release daughter cells after cell division. In general, bacterial MurNAc-LAAs are members of the bacterial autolytic system and carry a signal peptide in their N-termini that allows their transport across the cytoplasmic membrane. However, the bacteriophage MurNAc-LAAs are endolysins since these phage-encoded enzymes break down bacterial peptidoglycan at the terminal stage of the phage reproduction cycle. As opposed to autolysins, almost all endolysins have no signal peptides and their translocation through the cytoplasmic membrane is thought to proceed with the help of phage-encoded holin proteins. The amidase catalytic module is fused to another functional module (cell wall binding module or CWBM) either at the N- or C-terminus, which is responsible for high affinity binding of the protein to the cell wall.
NF033838	PspC_subgroup_1	8.35e-52	289	549	487	684	pneumococcal surface protein PspC, choline-binding form. The pneumococcal surface protein PspC, as described in Streptococcus pneumoniae, is a repetitive and highly variable protein, recognized by a conserved N-terminal domain and also by genomic location. This form, subgroup 1, has variable numbers of a choline-binding repeat in the C-terminal region, and is also known as choline-binding protein A. The other form, subgroup 2, is anchored covalently after cleavage by sortase at a C-terminal LPXTG site.
pfam01520	Amidase_3	2.03e-45	579	769	1	170	N-acetylmuramoyl-L-alanine amidase. This enzyme domain cleaves the amide bond between N-acetylmuramoyl and L-amino acids in bacterial cell walls.
COG0860	AmiC	1.07e-43	577	773	43	226	N-acetylmuramoyl-L-alanine amidase [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
APF24287.1	7.53e-265	1	775	1	765
BBK78145.1	3.03e-264	1	775	1	765
QSX04622.1	2.82e-252	20	775	1	746
QCJ08124.1	2.82e-252	20	775	1	746
QGH28125.1	2.82e-252	20	775	1	746

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1JWQ_A	1.47e-17	577	769	2	170	Structureof the catalytic domain of CwlV, N-acetylmuramoyl-L-alanine amidase from Bacillus(Paenibacillus) polymyxa var.colistinus [Paenibacillus polymyxa]
4RN7_A	1.14e-14	579	771	6	178	ChainA, N-acetylmuramoyl-L-alanine amidase [Clostridioides difficile 630]
5EMI_A	8.16e-14	578	768	6	171	ChainA, Cell wall hydrolase/autolysin [Nostoc punctiforme PCC 73102]
5J72_A	9.54e-14	576	747	451	609	ChainA, Putative N-acetylmuramoyl-L-alanine amidase,autolysin cwp6 [Clostridioides difficile 630],5J72_B Chain B, Putative N-acetylmuramoyl-L-alanine amidase,autolysin cwp6 [Clostridioides difficile 630]
7RAG_B	8.82e-12	577	767	17	201	ChainB, Germination-specific N-acetylmuramoyl-L-alanine amidase, Autolysin [Clostridioides difficile]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P54525	1.77e-21	576	767	29	196	Uncharacterized protein YqiI OS=Bacillus subtilis (strain 168) OX=224308 GN=yqiI PE=3 SV=3
Q02114	8.62e-19	576	767	319	487	N-acetylmuramoyl-L-alanine amidase LytC OS=Bacillus subtilis (strain 168) OX=224308 GN=lytC PE=1 SV=1
Q9RMZ0	6.37e-15	576	767	332	512	Uncharacterized cell wall amidase pXO2-42/BXB0045/GBAA_pXO2_0045 OS=Bacillus anthracis OX=1392 GN=pXO2-42 PE=3 SV=2
O48471	8.48e-14	577	773	3	179	Endolysin OS=Bacillus phage SPP1 OX=10724 GN=25 PE=4 SV=1
Q8CP02	1.62e-12	576	775	119	289	Probable cell wall amidase LytH OS=Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200) OX=176280 GN=lytH PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000270	0.999009	0.000174	0.000190	0.000164	0.000145

TMHMM  Annotations     

start	end
13	35