CAZyme Information: MGYG000003553_01966

Basic Information

• Species: HGM05376 sp900769785
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; P3; HGM05376; HGM05376 sp900769785
• CAZyme ID: MGYG000003553_01966
• CAZy Family: GH23
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
325	MGYG000003553_264|CGC1	37808.53	9.5246

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003553	2321768	MAG	Fiji	Oceania

• Gene Location: Start: 988; End: 1965 Strand: -

Full Sequence      

MKKLSIVAIVLSVITLSVQVFIFATDKINDDEVYSQALRKDYRIYSPVLPDTLYFAGERV
PMDIYYVREALDREILSNTYWHTNTILNMKRAHRFFPVIEPILKRYGVPEDFKYLCVIES
SLTNATSPAKAQGYWQFVKATGKKYGLEISDEVDMRNSLEASTEAACKFLKALYRQFGSW
TLAAAAYNCGENGLQRQINLQDVRNYYDLRLNSETARYVYRIVAMKLIMQNPQSYGFNLR
KRDLYPQLPYRTVELKGQNVDLYQFAKDNQTTYKMLREMNPWLISNKLVNKANKVYTVKL
PVKDGTLLENIRTAEDKQSTLVTYQ

Enzyme Prediction     

No EC number prediction in MGYG000003553_01966.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	96	230	2.6e-21	0.9037037037037037

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd16894	MltD-like	3.23e-59	103	226	1	128	Membrane-bound lytic murein transglycosylase D and similar proteins. Lytic transglycosylases (LT) catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc). Membrane-bound lytic murein transglycosylase D protein (MltD) family members may have one or more small LysM domains, which may contribute to peptidoglycan binding. Unlike the similar "goose-type" lysozymes, LTs also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria, the LTs in bacteriophage lambda, as well as the eukaryotic "goose-type" lysozymes (goose egg-white lysozyme; GEWL).
PRK10783	mltD	2.25e-25	55	281	65	293	membrane-bound lytic murein transglycosylase D; Provisional
pfam01464	SLT	4.81e-17	104	209	6	114	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.
cd00254	LT-like	2.42e-12	124	224	17	108	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
COG0741	MltE	1.86e-06	90	235	134	283	Soluble lytic murein transglycosylase and related regulatory proteins (some contain LysM/invasin domains) [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAG5078174.1	1.05e-99	34	302	52	320
QCY71242.1	1.10e-98	25	303	30	308
ADI17796.1	3.09e-97	19	316	20	318
AXP79478.1	4.19e-97	21	303	20	302
QQY83894.1	8.13e-97	21	303	20	302

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P0AEZ7	2.31e-21	55	243	62	255	Membrane-bound lytic murein transglycosylase D OS=Escherichia coli (strain K12) OX=83333 GN=mltD PE=1 SV=1
P0AEZ8	2.31e-21	55	243	62	255	Membrane-bound lytic murein transglycosylase D OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) OX=199310 GN=mltD PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.692056	0.300295	0.006039	0.000416	0.000301	0.000891

TMHMM  Annotations     

start	end
5	24