CAZyme Information: MGYG000003554_00242

Basic Information

• Species: UBA1232 sp900769735
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; UBA932; UBA1232; UBA1232 sp900769735
• CAZyme ID: MGYG000003554_00242
• CAZy Family: GT5
• CAZyme Description: Glycogen synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
275		31339.91	5.0909

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003554	1983378	MAG	Fiji	Oceania

• Gene Location: Start: 11354; End: 12181 Strand: -

Full Sequence      

MKESKKILFVNSEITPYLPESTISSVGRYLPQGIQENGKEIRSFMPRYGNINERRNQLHE
VIRLSGMNIVVNDIDRPLIIKVASISSARMQVYFIDNDDYFHRKFVYAGEDGKFFEDNDE
RAIFFARGVLETVKKLRWKPDIIHCQGWISHILPLYLKKAYKDDPIFTDCKVVLSLYNEI
ADETFADDMGSKVILPGIKNKDVEVLKTANGINLAKLAIQNADGIICGSPELPAEINEFA
AASKLPVLPYTDLSDSEYIKEYNQFYDKILGEDAI

Enzyme Prediction     

No EC number prediction in MGYG000003554_00242.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT5	6	237	9.7e-46	0.4682203389830508

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam08323	Glyco_transf_5	8.01e-55	7	230	1	218	Starch synthase catalytic domain.
PRK14098	PRK14098	1.98e-43	6	178	7	180	starch synthase.
cd03791	GT5_Glycogen_synthase_DULL1-like	1.23e-30	6	225	1	212	Glycogen synthase GlgA and similar proteins. This family is most closely related to the GT5 family of glycosyltransferases. Glycogen synthase (EC:2.4.1.21) catalyzes the formation and elongation of the alpha-1,4-glucose backbone using ADP-glucose, the second and key step of glycogen biosynthesis. This family includes starch synthases of plants, such as DULL1 in Zea mays and glycogen synthases of various organisms.
PRK00654	glgA	2.44e-21	6	178	2	155	glycogen synthase GlgA.
COG0297	GlgA	1.14e-18	6	230	2	217	Glycogen synthase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AGY54414.1	1.08e-128	18	274	1	259
QKG78761.1	1.05e-114	1	274	1	273
BAX80299.1	1.45e-114	3	272	2	269
AZS31272.1	3.77e-112	5	270	4	267
QRO49825.1	4.37e-111	5	270	4	267

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6GNF_A	2.48e-06	7	178	24	202	GranuleBound Starch Synthase from Cyanobacterium sp. CLg1 bound to acarbose and ADP [Cyanobacterium sp. CLg1],6GNF_B Granule Bound Starch Synthase from Cyanobacterium sp. CLg1 bound to acarbose and ADP [Cyanobacterium sp. CLg1],6GNF_C Granule Bound Starch Synthase from Cyanobacterium sp. CLg1 bound to acarbose and ADP [Cyanobacterium sp. CLg1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q3B6C3	2.12e-41	2	223	3	222	Glycogen synthase OS=Chlorobium luteolum (strain DSM 273 / BCRC 81028 / 2530) OX=319225 GN=glgA PE=3 SV=1
B3EGV0	1.11e-40	6	178	7	180	Glycogen synthase OS=Chlorobium limicola (strain DSM 245 / NBRC 103803 / 6330) OX=290315 GN=glgA PE=3 SV=1
B4S584	8.29e-39	6	178	7	180	Glycogen synthase OS=Prosthecochloris aestuarii (strain DSM 271 / SK 413) OX=290512 GN=glgA PE=3 SV=1
A1BIY8	2.16e-38	6	178	7	180	Glycogen synthase OS=Chlorobium phaeobacteroides (strain DSM 266) OX=290317 GN=glgA PE=3 SV=1
B4SC83	4.16e-37	6	178	7	180	Glycogen synthase OS=Pelodictyon phaeoclathratiforme (strain DSM 5477 / BU-1) OX=324925 GN=glgA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000047	0.000002	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003554_00242.