CAZyme Information: MGYG000003554_00472

Basic Information

• Species: UBA1232 sp900769735
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; UBA932; UBA1232; UBA1232 sp900769735
• CAZyme ID: MGYG000003554_00472
• CAZy Family: GH19
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
176		19793.26	7.2595

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003554	1983378	MAG	Fiji	Oceania

• Gene Location: Start: 1486; End: 2016 Strand: +

Full Sequence      

MRNELTAALLADIFSVKENDVAPFVPYLKKYCREYKINTPQRLAAFLAQVGHESGRFHYT
EEIASGAAYEGRLDLGNTEVGDGCKYKGRGLIQLTGRYNYSRLSDATGIDFIANPQALSE
PEYAVLSACWYWSDRGLNGLADSGHYNLITKKINGGYNGLADREYFHRRCKEALYL

Enzyme Prediction     

EC	3.2.1.17

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH19	38	134	2.1e-35	0.43722943722943725

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3179	COG3179	2.25e-43	5	174	4	204	Predicted chitinase [General function prediction only].
cd00325	chitinase_GH19	9.31e-17	5	157	1	190	Glycoside hydrolase family 19, chitinase domain. Chitinases are enzymes that catalyze the hydrolysis of the beta-1,4-N-acetyl-D-glucosamine linkages in chitin polymers. Glycoside hydrolase family 19 chitinases are found primarily in plants (classes I, III, and IV), but some are found in bacteria. Class I and II chitinases are similar in their catalytic domains. Class I chitinases have an N-terminal cysteine-rich, chitin-binding domain which is separated from the catalytic domain by a proline and glycine-rich hinge region. Class II chitinases lack both the chitin-binding domain and the hinge region. Class IV chitinases are similar to class I chitinases, but they are smaller in size due to certain deletions. Despite lacking any significant sequence homology with lysozymes, structural analysis reveals that family 19 chitinases, together with family 46 chitosanases, are similar to several lysozymes including those from T4-phage and from goose. The structures reveal that the different enzyme groups arose from a common ancestor glycohydrolase antecedent to the prokaryotic/eukaryotic divergence.
pfam00182	Glyco_hydro_19	6.49e-12	43	169	53	217	Chitinase class I.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AAW95192.1	1.16e-56	24	174	12	162
QIK55024.1	2.25e-56	18	174	17	181
QIK60455.1	7.39e-55	18	174	17	181
QDF08777.1	9.77e-55	24	174	161	311
AKQ70225.1	1.25e-54	24	174	224	374

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4OK7_A	2.11e-24	16	174	27	222	ChainA, Endolysin [Salmonella phage SPN1S],4OK7_B Chain B, Endolysin [Salmonella phage SPN1S],4OK7_C Chain C, Endolysin [Salmonella phage SPN1S]
1WVU_A	4.71e-11	44	156	109	221	Crystalstructure of chitinase C from Streptomyces griseus HUT6037 [Streptomyces griseus],1WVU_B Crystal structure of chitinase C from Streptomyces griseus HUT6037 [Streptomyces griseus],2DBT_A Crystal structure of chitinase C from Streptomyces griseus HUT6037 [Streptomyces griseus],2DBT_B Crystal structure of chitinase C from Streptomyces griseus HUT6037 [Streptomyces griseus],2DBT_C Crystal structure of chitinase C from Streptomyces griseus HUT6037 [Streptomyces griseus]
1WVV_A	1.22e-10	44	156	109	221	ChainA, chitinase C [Streptomyces griseus],1WVV_B Chain B, chitinase C [Streptomyces griseus]
2CJL_A	6.44e-10	41	133	45	139	CrystalStructure And Enzymatic Properties Of A Bacterial Family 19 Chitinase Reveal Differences With Plant Enzymes [Streptomyces coelicolor],2CJL_B Crystal Structure And Enzymatic Properties Of A Bacterial Family 19 Chitinase Reveal Differences With Plant Enzymes [Streptomyces coelicolor]
4MCK_A	5.93e-09	36	155	50	166	Crystalstructure of Family GH19, Class IV chitinase from Zea mays [Zea mays]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O64203	1.33e-25	7	174	182	358	Endolysin A OS=Mycobacterium phage D29 OX=28369 GN=10 PE=1 SV=1
P44187	8.89e-15	37	163	35	187	Glycosyl hydrolase family 19 domain-containing protein HI_1415 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=HI_1415 PE=3 SV=1
O22841	2.49e-12	35	156	131	249	Endochitinase At2g43620 OS=Arabidopsis thaliana OX=3702 GN=At2g43620 PE=3 SV=1
O22842	5.92e-11	35	156	129	247	Endochitinase At2g43610 OS=Arabidopsis thaliana OX=3702 GN=At2g43610 PE=1 SV=1
P29022	2.58e-09	36	155	127	244	Endochitinase A OS=Zea mays OX=4577 GN=CHIA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000064	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003554_00472.