CAZyme Information: MGYG000003554_01037

Basic Information

• Species: UBA1232 sp900769735
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; UBA932; UBA1232; UBA1232 sp900769735
• CAZyme ID: MGYG000003554_01037
• CAZy Family: GH23
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
310		35262.22	7.6142

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003554	1983378	MAG	Fiji	Oceania

• Gene Location: Start: 13248; End: 14180 Strand: -

Full Sequence      

MLALLASVAVYTVATAQTTESEGGFFSSLWGGSSSQQERPIQNVVVPKLPAEADFAGERV
PLEYFDVRESLQREMLIINYWHGSLSYIVQLSGRYKDMICKILKEEGVPEDFFYLCVAES
SLQPQTSPAGAKGYWQFLSGTAKDYGLEVGAEVDERYHWEKATRAACKYFKKGYAKYGTW
TLAAASYNVGMANIDSRIGYQSLKNYYDMQLPLETARYVYRAVAFKIMMNNLPEYGFNIP
EEERYKPIECKEVEVKGPVANWSEFARKHNSNFKMIKMCNEWIRSNKLTNKLGKTYKVLV
PVSREAAQGE

Enzyme Prediction     

No EC number prediction in MGYG000003554_01037.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	104	224	5.5e-18	0.8

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd16894	MltD-like	1.29e-55	103	227	1	129	Membrane-bound lytic murein transglycosylase D and similar proteins. Lytic transglycosylases (LT) catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc). Membrane-bound lytic murein transglycosylase D protein (MltD) family members may have one or more small LysM domains, which may contribute to peptidoglycan binding. Unlike the similar "goose-type" lysozymes, LTs also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria, the LTs in bacteriophage lambda, as well as the eukaryotic "goose-type" lysozymes (goose egg-white lysozyme; GEWL).
pfam01464	SLT	2.41e-16	101	209	4	114	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.
cd00254	LT-like	4.16e-12	118	221	10	105	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
PRK10783	mltD	1.75e-11	103	241	112	256	membrane-bound lytic murein transglycosylase D; Provisional
cd13403	MLTF-like	5.98e-07	119	194	22	99	membrane-bound lytic murein transglycosylase F (MLTF) and similar proteins. This subfamily includes membrane-bound lytic murein transglycosylase F (MltF, murein lyase F) that degrades murein glycan strands. It is responsible for catalyzing the release of 1,6-anhydromuropeptides from peptidoglycan. Lytic transglycosylase catalyzes the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc) as do goose-type lysozymes. However, in addition, it also makes a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AGY52829.1	7.33e-109	31	301	21	293
ALO15094.1	9.23e-86	49	301	50	302
CAG5078174.1	2.77e-85	33	305	51	323
QKG79340.1	4.97e-83	33	301	36	305
CDN30733.1	9.05e-83	48	300	27	281

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000461	0.998852	0.000158	0.000185	0.000161	0.000149

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003554_01037.