CAZyme Information: MGYG000003554_01359

Basic Information

• Species: UBA1232 sp900769735
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; UBA932; UBA1232; UBA1232 sp900769735
• CAZyme ID: MGYG000003554_01359
• CAZy Family: GH19
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
184		21110.04	8.5732

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003554	1983378	MAG	Fiji	Oceania

• Gene Location: Start: 1703; End: 2257 Strand: -

Full Sequence      

MSRILDFGGIDRLSEHSLSDMLATTYTTAKKYVNWLNEYCARYKINTPLRLAAFLAQIGH
ESCRLCFSEEIARGDAYEGRKDLGNIHKGDGKKYKGRGLIQVTGRYNYEAISNDLGIDFL
NNPELLALPEYAVWSACWFWDKHNLNALADEGKFRDITRKINGGYNGLEDREKLYARCKR
ILKV

Enzyme Prediction     

No EC number prediction in MGYG000003554_01359.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH19	44	144	2.2e-36	0.45021645021645024

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3179	COG3179	4.73e-39	36	182	27	204	Predicted chitinase [General function prediction only].
cd00325	chitinase_GH19	2.27e-23	25	184	22	216	Glycoside hydrolase family 19, chitinase domain. Chitinases are enzymes that catalyze the hydrolysis of the beta-1,4-N-acetyl-D-glucosamine linkages in chitin polymers. Glycoside hydrolase family 19 chitinases are found primarily in plants (classes I, III, and IV), but some are found in bacteria. Class I and II chitinases are similar in their catalytic domains. Class I chitinases have an N-terminal cysteine-rich, chitin-binding domain which is separated from the catalytic domain by a proline and glycine-rich hinge region. Class II chitinases lack both the chitin-binding domain and the hinge region. Class IV chitinases are similar to class I chitinases, but they are smaller in size due to certain deletions. Despite lacking any significant sequence homology with lysozymes, structural analysis reveals that family 19 chitinases, together with family 46 chitosanases, are similar to several lysozymes including those from T4-phage and from goose. The structures reveal that the different enzyme groups arose from a common ancestor glycohydrolase antecedent to the prokaryotic/eukaryotic divergence.
pfam00182	Glyco_hydro_19	1.11e-14	51	184	53	224	Chitinase class I.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QIK60455.1	1.48e-61	24	184	15	183
QIK55024.1	4.22e-61	24	184	15	183
QIK58799.1	2.75e-56	24	183	14	180
QVW29068.1	4.09e-55	13	182	3	176
QBI60946.1	4.09e-55	13	182	3	176

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4OK7_A	2.34e-21	81	182	123	222	ChainA, Endolysin [Salmonella phage SPN1S],4OK7_B Chain B, Endolysin [Salmonella phage SPN1S],4OK7_C Chain C, Endolysin [Salmonella phage SPN1S]
4IJ4_A	4.28e-14	51	164	51	166	CrystalStructure of a Family GH19 chitinase from Bryum coronatum in complex with (GlcNAc)4 [Gemmabryum coronatum]
3WH1_A	8.41e-14	51	164	52	167	CrystalStructure of a Family GH19 Chitinase from Bryum coronatum in complex with (GlcNAc)4 at 1.0 A resolution [Gemmabryum coronatum]
7F88_A	3.79e-12	51	164	58	158	ChainA, Chitinase A [Gemmabryum coronatum],7F88_B Chain B, Chitinase A [Gemmabryum coronatum],7F88_C Chain C, Chitinase A [Gemmabryum coronatum]
4MCK_A	1.49e-11	51	163	57	166	Crystalstructure of Family GH19, Class IV chitinase from Zea mays [Zea mays]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O64203	3.41e-22	48	175	215	354	Endolysin A OS=Mycobacterium phage D29 OX=28369 GN=10 PE=1 SV=1
O22841	7.13e-18	51	164	140	249	Endochitinase At2g43620 OS=Arabidopsis thaliana OX=3702 GN=At2g43620 PE=3 SV=1
O22842	9.64e-18	38	164	124	247	Endochitinase At2g43610 OS=Arabidopsis thaliana OX=3702 GN=At2g43610 PE=1 SV=1
P44187	7.53e-16	70	175	90	191	Glycosyl hydrolase family 19 domain-containing protein HI_1415 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=HI_1415 PE=3 SV=1
P42820	2.44e-13	51	163	139	252	Acidic endochitinase SP2 OS=Beta vulgaris OX=161934 GN=SP2 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000035	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003554_01359.