CAZyme Information: MGYG000003556_01784

Basic Information

• Species: Alistipes sp900769745
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Rikenellaceae; Alistipes; Alistipes sp900769745
• CAZyme ID: MGYG000003556_01784
• CAZy Family: GH16
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
311		36222.2	8.5118

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003556	2131277	MAG	Fiji	Oceania

• Gene Location: Start: 371; End: 1306 Strand: +

Full Sequence      

MKNKIIASLLFVVFLSTLNIELSAQEKKSAPQPKFHKKFIEHFDKPTSKYFNQNGGRRRS
STQMRYIPATSSFCEKDSKVMMMRIDPTDPAGPGRGPEICSKDYTYYGSYSARIRIPEAS
AVQPNVGAVVGYFTYNMEREKGLSEIDWEWLIADPEIIYIGTWTGKGDNLQRIGRIINLA
KGTIYECIYKPTAEGIKDNRLTGLQNQPETVPVIEGYNAAKRFYTYGFDWYPDRIVWWML
HPETQERIVLWDYQGSTPNFSGIPDNKTRYLLNFWHTNNWPVHTNPKSIEKPKYPYEVEI
DWMSYEPFDIR

Enzyme Prediction     

No EC number prediction in MGYG000003556_01784.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd00413	Glyco_hydrolase_16	1.23e-17	41	303	1	207	glycosyl hydrolase family 16. The O-Glycosyl hydrolases are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A glycosyl hydrolase classification system based on sequence similarity has led to the definition of more than 95 different families inlcuding glycosyl hydrolase family 16. Family 16 includes lichenase, xyloglucan endotransglycosylase (XET), beta-agarase, kappa-carrageenase, endo-beta-1,3-glucanase, endo-beta-1,3-1,4-glucanase, and endo-beta-galactosidase, all of which have a conserved jelly roll fold with a deep active site channel harboring the catalytic residues.
cd02175	GH16_lichenase	9.63e-11	86	307	47	212	lichenase, member of glycosyl hydrolase family 16. Lichenase, also known as 1,3-1,4-beta-glucanase, is a member of glycosyl hydrolase family 16, that specifically cleaves 1,4-beta-D-glucosidic bonds in mixed-linked beta glucans that also contain 1,3-beta-D-glucosidic linkages. Natural substrates of beta-glucanase are beta-glucans from grain endosperm cell walls or lichenan from the Islandic moss, Cetraria islandica. This protein is found not only in bacteria but also in anaerobic fungi. This domain includes two seven-stranded antiparallel beta-sheets that are adjacent to one another forming a compact, jellyroll beta-sandwich structure.
pfam00722	Glyco_hydro_16	3.96e-06	96	238	22	119	Glycosyl hydrolases family 16.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QHT65269.1	2.95e-120	34	307	23	290
SMD43921.1	4.83e-119	35	310	24	293
QHT68766.1	1.21e-116	1	311	1	294
QDH80247.1	1.19e-112	2	307	3	291
CEA16211.1	1.34e-112	4	309	14	311

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000256	0.998967	0.000230	0.000171	0.000171	0.000152

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003556_01784.