CAZyme Information: MGYG000003557_00259

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Acutalibacteraceae; CAG-180
• CAZyme ID: MGYG000003557_00259
• CAZy Family: GH146
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
581		66442.75	5.3569

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003557	1241899	MAG	Fiji	Oceania

• Gene Location: Start: 2712; End: 4457 Strand: -

Full Sequence      

MQNVTLLDKYEQNAFEKEIKYLKSLDKNRLLKGFCEIAGRELNAEKYGGWETSAIQGHTL
GHYITAVAQAYASSGDIELKAITDYMISVLRECQRPNGYLHAIPENHYDKLETGDTSGTW
VPWYSMHKVLAGLIDVYTFTGNKDALQLASKLGDWVYSHTSKWTEETQKTVLDIEYGGMN
DCLYNLYKYTKSENHLSAAHSFDEMSLFEPLFNGEDILNGKHANTTIPKIIGALNRYTVT
NEDFYLKVAENFWKIVTENHTYITGGNSEWEHFGEPKVLDAERTNCNCETCNTYNMLKLT
RTLFKVTGNKKYCDYYENTFINAILSSQNPTTGMTTYFQPMATGYFKVYSSPYDHFWCCT
GSGMENFSKLGDSIYFHSNDALFVNRYTSSSINWTEKGITVTQNADLPDVKFTINGNTQG
KIVLRVPDWCKEKPTITINGEAYDVVINNGFVMIEREFFDGDVIEYHMNMQITVHPLPDN
ENSVAFKYGPWVLSADIGTDNMKTDVTGVNVTIPMACDNMSDVLVIQNDTVENWLSNINE
NLVKWDNELKFTLKGTDRKLVFSPHYKQHTNRYGIYFKCRV

Enzyme Prediction     

No EC number prediction in MGYG000003557_00259.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH146	4	493	1.7e-189	0.9940357852882704

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07944	Glyco_hydro_127	4.51e-160	3	494	1	503	Beta-L-arabinofuranosidase, GH127. One member of this family, from Bidobacterium longicum, UniProtKB:E8MGH8, has been characterized as an unusual beta-L-arabinofuranosidase enzyme, EC:3.2.1.185. It rleases l-arabinose from the l-arabinofuranose (Araf)-beta1,2-Araf disaccharide and also transglycosylates 1-alkanols with retention of the anomeric configuration. Terminal beta-l-arabinofuranosyl residues have been found in arabinogalactan proteins from a mumber of different plantt species. beta-l-Arabinofuranosyl linkages with 1-4 arabinofuranosides are also found in the sugar chains of extensin and solanaceous lectins, hydroxyproline (Hyp)2-rich glycoproteins that are widely observed in plant cell wall fractions. The critical residue for catalytic activity is Glu-338, in a ET/SCAS sequence context.
COG3533	COG3533	2.99e-107	4	500	12	507	Uncharacterized conserved protein, DUF1680 family [Function unknown].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEY65668.1	6.85e-229	1	577	1	583
APC42636.1	4.76e-224	1	577	1	583
AIQ16786.1	2.50e-221	1	578	21	607
AZK46778.1	7.61e-220	1	577	17	602
BCG58068.1	2.09e-219	1	578	16	602

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6YQH_AAA	8.25e-104	1	578	30	649	ChainAAA, Acetyl-CoA carboxylase, biotin carboxylase [Bacteroides thetaiotaomicron VPI-5482]
5OPJ_A	5.83e-98	1	578	30	649	Beta-L-arabinofuranosidase[Bacteroides thetaiotaomicron]
6EX6_A	5.40e-27	35	496	41	547	TheGH127, Beta-arabinofuranosidase, BT3674 [Bacteroides thetaiotaomicron VPI-5482],6EX6_B The GH127, Beta-arabinofuranosidase, BT3674 [Bacteroides thetaiotaomicron VPI-5482]
4QJY_A	7.20e-27	37	492	60	558	Crystalstructure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QJY_B Crystal structure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
4QK0_A	1.28e-25	37	492	60	558	Crystalstructure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_B Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_C Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_D Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
E8MGH8	2.22e-12	36	532	58	606	Non-reducing end beta-L-arabinofuranosidase OS=Bifidobacterium longum subsp. longum (strain ATCC 15707 / DSM 20219 / JCM 1217 / NCTC 11818 / E194b) OX=565042 GN=hypBA1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000060	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003557_00259.