CAZyme Information: MGYG000003560_00095

Basic Information

• Species: UMGS1820 sp900769795
• Lineage: Bacteria; Firmicutes_A; Clostridia; Monoglobales; Monoglobaceae; UMGS1820; UMGS1820 sp900769795
• CAZyme ID: MGYG000003560_00095
• CAZy Family: GH23
• CAZyme Description: Membrane-bound lytic murein transglycosylase C

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
210		24279.5	7.6733

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003560	1363784	MAG	Fiji	Oceania

• Gene Location: Start: 16116; End: 16748 Strand: +

Full Sequence      

MRRAANAGRRRRRRQGCITGIFKFIIFIAVVIGLGFFLARTYLESDLATKIQKTLYPIKY
EYFVEEYSQEYDVDKYLVYSVIRTESRYDRYAVSSAGAKGLMQLTDETGEHCAKRLKIEN
YTNDALFDPETNIKLGCYYLSVLIDKYEDTNTALAAYNGGPGNVDSWLNDKNYTDEAGSL
INIPFKETKNYVVRVREAQNMYKSIYDNIE

Enzyme Prediction     

No EC number prediction in MGYG000003560_00095.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	73	202	1.3e-27	0.8148148148148148

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd16896	LT_Slt70-like	5.38e-71	57	201	1	146	uncharacterized lytic transglycosylase subfamily with similarity to Slt70. Uncharacterized lytic transglycosylase (LT) with a conserved sequence pattern suggesting similarity to the Slt70, a 70kda soluble lytic transglycosylase which also has an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd13401	Slt70-like	1.44e-56	55	205	1	152	70kDa soluble lytic transglycosylase (Slt70) and similar proteins. Catalytic domain of the 70kda soluble lytic transglycosylase (LT)-like proteins, which also have an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.
cd00254	LT-like	3.34e-38	77	200	3	111	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
COG0741	MltE	6.61e-37	48	206	125	287	Soluble lytic murein transglycosylase and related regulatory proteins (some contain LysM/invasin domains) [Cell wall/membrane/envelope biogenesis].
cd16893	LT_MltC_MltE	3.42e-33	63	200	2	162	membrane-bound lytic murein transglycosylases MltC and MltE, and similar proteins. MltC and MltE are periplasmic, outer membrane attached lytic transglycosylases (LTs), which cleave beta-1,4-glycosidic bonds joining N-acetylmuramic acid and N-acetylglucosamine in the cell wall peptidoglycan, yielding 1,6-anhydromuropeptides. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AUO18574.1	5.45e-58	15	207	18	214
ACL76418.1	2.98e-53	18	207	14	192
AEY66639.1	1.26e-49	11	208	5	193
QJA07934.1	1.83e-48	23	207	4	178
SLK19900.1	8.67e-47	22	206	3	179

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6FBT_A	3.38e-15	78	202	467	592	ChainA, Lytic murein transglycosylase [Pseudomonas aeruginosa]
5OHU_A	3.43e-15	78	202	496	621	TheX-ray Structure of Lytic Transglycosylase Slt from Pseudomonas aeruginosa [Pseudomonas aeruginosa]
6FC4_A	8.44e-15	78	202	468	593	ChainA, Soluble lytic murein transglycosylase [Pseudomonas aeruginosa]
6FCQ_A	8.44e-15	78	202	467	592	ChainA, Soluble lytic murein transglycosylase [Pseudomonas aeruginosa],6FCR_A Chain A, Soluble lytic murein transglycosylase [Pseudomonas aeruginosa],6FCS_A Chain A, Soluble lytic murein transglycosylase [Pseudomonas aeruginosa],6FCU_A Chain A, Soluble lytic murein transglycosylase [Pseudomonas aeruginosa]
4C5F_A	8.49e-14	59	203	173	339	Structureof Lytic Transglycosylase MltC from Escherichia coli at 2.3 A resolution. [Escherichia coli],4C5F_B Structure of Lytic Transglycosylase MltC from Escherichia coli at 2.3 A resolution. [Escherichia coli]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O31608	4.56e-18	64	195	64	175	Putative murein lytic transglycosylase YjbJ OS=Bacillus subtilis (strain 168) OX=224308 GN=yjbJ PE=3 SV=1
P39434	6.73e-18	56	203	476	626	Soluble lytic murein transglycosylase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=slt PE=3 SV=2
O31976	3.05e-14	56	195	1418	1537	SPbeta prophage-derived uncharacterized transglycosylase YomI OS=Bacillus subtilis (strain 168) OX=224308 GN=yomI PE=3 SV=2
O64046	3.05e-14	56	195	1418	1537	Probable tape measure protein OS=Bacillus phage SPbeta OX=66797 GN=yomI PE=3 SV=1
Q3YXF0	1.46e-13	59	203	191	357	Membrane-bound lytic murein transglycosylase C OS=Shigella sonnei (strain Ss046) OX=300269 GN=mltC PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999375	0.000461	0.000021	0.000003	0.000002	0.000155

TMHMM  Annotations     

start	end
21	43