CAZyme Information: MGYG000003560_00335

Basic Information

• Species: UMGS1820 sp900769795
• Lineage: Bacteria; Firmicutes_A; Clostridia; Monoglobales; Monoglobaceae; UMGS1820; UMGS1820 sp900769795
• CAZyme ID: MGYG000003560_00335
• CAZy Family: GH105
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
675	MGYG000003560_19|CGC1	77939.14	4.8349

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003560	1363784	MAG	Fiji	Oceania

• Gene Location: Start: 12628; End: 14655 Strand: -

Full Sequence      

MRVKMEPAALKAELKRIIERMLKTRPRAEIKNKPFIKMDGVEHIFRQGVKVDLSKIYPEA
KPGDVAYIKSSIKLPAEPEISIHAKGNCDVYFNGKLVFTCDTFEGNHTQNLKIEDVPANE
GFNDLTIVCTATEEGFGAYFKISHNYGRDVWASDYHVWARKTLPFDEGYDEEGIAISALY
HERVDNPEYVLPTPCEEDDKVDYTKLYNKTGNAVAVSWAKEDVNVVIDTLNETKIWVNDD
EIEGTEASLKAGDRICVMTKGDDKEWGFTAKGTEKLSLPILDTKRTVGTHWLHVGVMADD
FTPDKIQFIKPYIDKDGEKSFWRFARPDMYMRPYLDSSFYGQWYYALMVGEYGILRASDY
FPEYYSYFHDSMMTMVRYFDYINYDRAMFGNTTFMPRAASLTNPDMIGAAGMCLCELYDR
VDEDEKKEILYLIDIMEEALYKHTPRMEDGAFYRVSTMWADESFMTCPFIMRMGIIKNKP
ENFDDVVNNLLCYKKRLWMEDKHIFSHIYFPPENVANRVPWGRGNGWVFFTLIDILERLP
KDVKRRDELEELYKEFAEGLLKYQSDSGMWRQVLDIDTSYKETSGTTIFTMGMLRGIMNG
ILPEKFVDVVKKSLSDLLDKMIDEKGDVLGVCRGSQCSMNAQYYCDLKDIKNDDHGTGVV
IAAMCEMIKMLELQG

Enzyme Prediction     

No EC number prediction in MGYG000003560_00335.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	342	669	2.4e-68	0.963855421686747

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07470	Glyco_hydro_88	3.31e-47	312	671	1	343	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.
COG4225	YesR	5.46e-39	409	671	83	357	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].
cd05355	SDR_c1	0.007	192	253	9	85	classical (c) SDR, subgroup 1. These proteins are members of the classical SDR family, with a canonical active site tetrad and a typical Gly-rich NAD-binding motif. SDRs are a functionally diverse family of oxidoreductases that have a single domain with a structurally conserved Rossmann fold (alpha/beta folding pattern with a central beta-sheet), an NAD(P)(H)-binding region, and a structurally diverse C-terminal region. Classical SDRs are typically about 250 residues long, while extended SDRs are approximately 350 residues. Sequence identity between different SDR enzymes are typically in the 15-30% range, but the enzymes share the Rossmann fold NAD-binding motif and characteristic NAD-binding and catalytic sequence patterns. These enzymes catalyze a wide range of activities including the metabolism of steroids, cofactors, carbohydrates, lipids, aromatic compounds, and amino acids, and act in redox sensing. Classical SDRs have an TGXXX[AG]XG cofactor binding motif and a YXXXK active site motif, with the Tyr residue of the active site motif serving as a critical catalytic residue (Tyr-151, human 15-hydroxyprostaglandin dehydrogenase (15-PGDH) numbering). In addition to the Tyr and Lys, there is often an upstream Ser (Ser-138, 15-PGDH numbering) and/or an Asn (Asn-107, 15-PGDH numbering) contributing to the active site; while substrate binding is in the C-terminal region, which determines specificity. The standard reaction mechanism is a 4-pro-S hydride transfer and proton relay involving the conserved Tyr and Lys, a water molecule stabilized by Asn, and nicotinamide. Extended SDRs have additional elements in the C-terminal region, and typically have a TGXXGXXG cofactor binding motif. Complex (multidomain) SDRs such as ketoreductase domains of fatty acid synthase have a GGXGXXG NAD(P)-binding motif and an altered active site motif (YXXXN). Fungal type ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding motif. Some atypical SDRs have lost catalytic activity and/or have an unusual NAD(P)-binding motif and missing or unusual active site residues. Reactions catalyzed within the SDR family include isomerization, decarboxylation, epimerization, C=N bond reduction, dehydratase activity, dehalogenation, Enoyl-CoA reduction, and carbonyl-alcohol oxidoreduction.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QOV19133.1	3.02e-112	17	670	26	738
AGI39075.1	8.42e-72	52	672	59	716
AGC68044.1	8.42e-72	52	672	59	716
ANW98436.1	8.42e-72	52	672	59	716
QLG42731.1	2.12e-71	51	670	58	720

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3K11_A	1.97e-22	401	674	139	417	Crystalstructure of Putative glycosyl hydrolase (NP_813087.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 1.80 A resolution [Bacteroides thetaiotaomicron VPI-5482]
1NC5_A	3.41e-19	410	675	92	372	Structureof Protein of Unknown Function of YteR from Bacillus Subtilis [Bacillus subtilis],2D8L_A Crystal Structure of Unsaturated Rhamnogalacturonyl Hydrolase in complex with dGlcA-GalNAc [Bacillus subtilis]
2GH4_A	1.33e-18	410	675	82	362	ChainA, Putative glycosyl hydrolase yteR [Bacillus subtilis]
4CE7_A	3.45e-18	459	670	154	369	Crystalstructure of a novel unsaturated beta-glucuronyl hydrolase enzyme, belonging to family GH105, involved in ulvan degradation [Nonlabens ulvanivorans],4CE7_B Crystal structure of a novel unsaturated beta-glucuronyl hydrolase enzyme, belonging to family GH105, involved in ulvan degradation [Nonlabens ulvanivorans],4CE7_C Crystal structure of a novel unsaturated beta-glucuronyl hydrolase enzyme, belonging to family GH105, involved in ulvan degradation [Nonlabens ulvanivorans]
4WU0_A	6.09e-16	445	666	110	357	StructuralAnalysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824],4WU0_B Structural Analysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O34559	1.87e-18	410	675	92	372	Unsaturated rhamnogalacturonyl hydrolase YteR OS=Bacillus subtilis (strain 168) OX=224308 GN=yteR PE=1 SV=1
L7P9J4	2.03e-17	459	670	161	376	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Nonlabens ulvanivorans OX=906888 GN=IL45_01505 PE=1 SV=1
P9WF04	1.20e-16	459	668	201	409	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_28 PE=1 SV=1
O31521	1.69e-13	416	669	92	337	Unsaturated rhamnogalacturonyl hydrolase YesR OS=Bacillus subtilis (strain 168) OX=224308 GN=yesR PE=1 SV=1
T2KPL9	2.97e-13	459	619	159	331	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22220 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000057	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003560_00335.