CAZyme Information: MGYG000003563_01180

Basic Information

• Species: CAG-831 sp900769885
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; UBA932; CAG-831; CAG-831 sp900769885
• CAZyme ID: MGYG000003563_01180
• CAZy Family: GH97
• CAZyme Description: Glucan 1,4-alpha-glucosidase SusB

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
665		75619.98	4.521

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003563	1678929	MAG	Fiji	Oceania

• Gene Location: Start: 2376; End: 4373 Strand: +

Full Sequence      

MAFIALSCADTDNVVKSPDGRWAIEFGISDNGSLYYCVKDCRTGSDLISESMLGLDFFEF
DSLQRFSLREIKHNAFSESWTQPWGENKVVTDRHNQMVIVLSDSLGNSMNVRFRAFDDGV
AFRYEYETIYDSLRVVKELTEFNLCADGIAWYADANFESYEMEYKQASLSEVASASTPFV
FKSSQRYFAIHEAALYDFPEMVLVNEDSLSFKGYLAPYYKGVRAVVPGNFITPWRTIQLS
DDAVGLINSTMILNLNESCKIEDSSWIKPQKYIGVWWEMHLGTKEWKEGPRHGATTFEAL
RYIDFAAENSIDGVLFEGWNKGWENWGGSQEFDYVNSSGDFDLDSVVAYAGKKGVSVWMH
NETGGNIYDYESKMEDAFRMYRDLGIHYLKTGYAGGMPENIRHHSQKGVNHYQKVVELAA
KYQIALDVHEPIKETGIRRTWPNMMTREGARGMEWNAWSRGNSSDYLTILPFVRLLAGPM
DYTPGVFDIYFERACADSGRVQWNGDNSQCFIKTTLARQIANWVIIYSPLQMACDMIENY
QGHPAFEFFREFDPDCDWSEALLGEIGEYIVVARRAKGKFYVGAGTNSEGRVVELPLDFL
EDGVLYKAKIYGDDLGAEVICQPDGTFAPDKRSYVIVEKFVSDKDSLRIEMAPDGGQAIF
FEPVV

Enzyme Prediction     

No EC number prediction in MGYG000003563_01180.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH97	4	661	1.2e-201	0.9889064976228209

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam10566	Glyco_hydro_97	2.20e-127	263	552	1	277	Glycoside hydrolase 97. This domain is the catalytic region of the bacterial glycosyl-hydrolase family 97. This central part of the GH97 family protein sequences represents a typical and complete (beta/alpha)8-barrel or catalytic TIM-barrel type domain. The N- and C-terminal parts of the sequences, mainly consisting of beta-strands, form two additional non-catalytic domains. In all known glycosidases with the (beta-alpha)8-barrel fold, the amino acid residues at the active site are located on the C-termini of the beta-strands.
pfam14508	GH97_N	1.85e-67	17	257	1	234	Glycosyl-hydrolase 97 N-terminal. This N-terminal domain of glycosyl-hydrolase-97 contributes part of the active site pocket. It is also important for contact with the catalytic and C-terminal domains of the whole.
pfam14509	GH97_C	1.85e-28	556	659	1	94	Glycosyl-hydrolase 97 C-terminal, oligomerization. Glycosyl-hydrolase-97 is made up of three tightly linked and highly conserved globular domains. The C-terminal domain is found to be necessary for oligomerization of the whole molecule in order to create the active-site pocket and the Ca++-binding site.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AFL77433.1	3.06e-279	1	664	17	669
CBK63835.1	4.34e-279	1	664	17	669
BBL01467.1	1.89e-277	2	663	9	666
ASB37496.1	1.19e-267	1	664	11	663
QQR08228.1	1.19e-267	1	664	11	663

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5HQC_A	2.84e-157	15	665	3	662	AGlycoside Hydrolase Family 97 enzyme R171K variant from Pseudoalteromonas sp. strain K8 [Pseudoalteromonas sp. K8]
5HQ4_A	4.02e-157	15	665	3	662	AGlycoside Hydrolase Family 97 enzyme from Pseudoalteromonas sp. strain K8 [Pseudoalteromonas sp. K8],5HQA_A A Glycoside Hydrolase Family 97 enzyme in complex with Acarbose from Pseudoalteromonas sp. strain K8 [Pseudoalteromonas sp. K8]
5HQB_A	1.13e-156	15	665	3	662	AGlycoside Hydrolase Family 97 enzyme (E480Q) in complex with Panose from Pseudoalteromonas sp. strain K8 [Pseudoalteromonas sp. K8]
3WFA_A	7.28e-131	15	664	5	706	Catalyticrole of the calcium ion in GH97 inverting glycoside hydrolase [Bacteroides thetaiotaomicron],3WFA_B Catalytic role of the calcium ion in GH97 inverting glycoside hydrolase [Bacteroides thetaiotaomicron]
2JKA_A	7.48e-131	15	664	14	715	Nativestructure of a family 97 alpha-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],2JKA_B Native structure of a family 97 alpha-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],2JKE_A Structure of a family 97 alpha-glucosidase from Bacteroides thetaiotaomicron in complex with deoxynojirimycin [Bacteroides thetaiotaomicron VPI-5482],2JKE_B Structure of a family 97 alpha-glucosidase from Bacteroides thetaiotaomicron in complex with deoxynojirimycin [Bacteroides thetaiotaomicron VPI-5482],2JKP_A Structure of a family 97 alpha-glucosidase from Bacteroides thetaiotaomicron in complex with castanospermine [Bacteroides thetaiotaomicron VPI-5482],2JKP_B Structure of a family 97 alpha-glucosidase from Bacteroides thetaiotaomicron in complex with castanospermine [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
G8JZS4	2.55e-131	1	664	10	726	Glucan 1,4-alpha-glucosidase SusB OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50) OX=226186 GN=susB PE=1 SV=1
Q8A6L0	1.21e-48	110	659	113	659	Retaining alpha-galactosidase OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50) OX=226186 GN=BT_1871 PE=1 SV=1
D7CFN7	8.39e-30	42	628	65	617	Probable retaining alpha-galactosidase OS=Streptomyces bingchenggensis (strain BCW-1) OX=749414 GN=SBI_01652 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999989	0.000044	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003563_01180.