CAZyme Information: MGYG000003564_00307

Basic Information

• Species: UBA1232 sp004561775
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; UBA932; UBA1232; UBA1232 sp004561775
• CAZyme ID: MGYG000003564_00307
• CAZy Family: GH18
• CAZyme Description: Chitinase A1

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
369	MGYG000003564_60|CGC1	40647.95	8.1718

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003564	1730489	MAG	Fiji	Oceania

• Gene Location: Start: 24; End: 1133 Strand: +

Full Sequence      

MTATLLTSCSKGALDPDPTPDPNPNPPTDQMADRVEGRVVAAYVTYYGSALPDPKYVTHI
MYAFAELYVENGVYKGFKLKGGETRFKNVMGLKQQNPNIKILLSFSHTVSNSDNSQGGGF
SALAKSAEYRSKFAEDCLNYINAKGLDGVDIDWEFPGISWSGHACDPKVDVENHVLLLKA
LREKFGSAKLVTYAGYVMDKQKSTSSSGGWKYIDISAANPYVDFVNIMSYDMDADGKPHN
ALSNSKAYRDCKRAVQSYLNAGVKAEKLVLGIPFYGRRSFSGSNAAISYKAIMKLGAEYV
KENWDNTSSVPYVSYNGAYYCSYDNPKSIGLKGSWLLSLGMKGMMYWECDQDDSSRTLAK
AVWNSTMAK

Enzyme Prediction     

No EC number prediction in MGYG000003564_00307.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH18	52	362	8.6e-58	0.8817567567567568

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06548	GH18_chitinase	4.32e-75	40	352	1	322	The GH18 (glycosyl hydrolases, family 18) type II chitinases hydrolyze chitin, an abundant polymer of N-acetylglucosamine and have been identified in bacteria, fungi, insects, plants, viruses, and protozoan parasites. The structure of this domain is an eight-stranded alpha/beta barrel with a pronounced active-site cleft at the C-terminal end of the beta-barrel.
pfam00704	Glyco_hydro_18	2.39e-57	39	352	1	307	Glycosyl hydrolases family 18.
smart00636	Glyco_18	4.34e-57	39	352	1	334	Glyco_18 domain.
cd02872	GH18_chitolectin_chitotriosidase	5.93e-54	53	353	24	342	This conserved domain family includes a large number of catalytically inactive chitinase-like lectins (chitolectins) including YKL-39, YKL-40 (HCGP39), YM1, oviductin, and AMCase (acidic mammalian chitinase), as well as catalytically active chitotriosidases. The conserved domain is an eight-stranded alpha/beta barrel fold belonging to the family 18 glycosyl hydrolases. The fold has a pronounced active-site cleft at the C-terminal end of the beta-barrel. The chitolectins lack a key active site glutamate (the proton donor required for hydrolytic activity) but retain highly conserved residues involved in oligosaccharide binding. Chitotriosidase is a chitinolytic enzyme expressed in maturing macrophages, which suggests that it plays a part in antimicrobial defense. Chitotriosidase hydrolyzes chitotriose, as well as colloidal chitin to yield chitobiose and is therefore considered an exochitinase. Chitotriosidase occurs in two major forms, the large form being converted to the small form by either RNA or post-translational processing. Although the small form, containing the chitinase domain alone, is sufficient for the chitinolytic activity, the additional C-terminal chitin-binding domain of the large form plays a role in processing colloidal chitin. The chitotriosidase gene is nonessential in humans, as about 35% of the population are heterozygous and 6% homozygous for an inactivated form of the gene. HCGP39 is a 39-kDa human cartilage glycoprotein thought to play a role in connective tissue remodeling and defense against pathogens.
COG3325	ChiA	4.00e-37	53	359	61	430	Chitinase, GH18 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AGY54522.1	9.13e-156	5	369	16	376
QEC44030.1	1.34e-139	6	369	15	371
QBJ17256.1	2.71e-135	30	369	38	375
QQA31286.1	3.84e-135	30	369	38	375
QUT99830.1	3.84e-135	30	369	38	375

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5GZU_A	8.13e-37	83	369	94	394	CrystalStructure of Chitinase ChiW from Paenibacillus sp. str. FPU-7 Reveals a Novel Type of Bacterial Cell-Surface-Expressed Multi-Modular Enzyme Machinery [Paenibacillus sp. FPU-7],5GZU_B Crystal Structure of Chitinase ChiW from Paenibacillus sp. str. FPU-7 Reveals a Novel Type of Bacterial Cell-Surface-Expressed Multi-Modular Enzyme Machinery [Paenibacillus sp. FPU-7],5GZV_A Crystal Structure of Chitinase ChiW from Paenibacillus sp. str. FPU-7 Reveals a Novel Type of Bacterial Cell-Surface-Expressed Multi-Modular Enzyme Machinery [Paenibacillus sp. FPU-7],5GZV_B Crystal Structure of Chitinase ChiW from Paenibacillus sp. str. FPU-7 Reveals a Novel Type of Bacterial Cell-Surface-Expressed Multi-Modular Enzyme Machinery [Paenibacillus sp. FPU-7]
5GZT_B	9.13e-37	83	369	345	645	CrystalStructure of Chitinase ChiW from Paenibacillus sp. str. FPU-7 Reveals a Novel Type of Bacterial Cell-Surface-Expressed Multi-Modular Enzyme Machinery [Paenibacillus sp. FPU-7]
6TSB_AAA	5.82e-33	39	355	37	340	ChainAAA, Peroxiredoxin [Clostridioides difficile 630]
6T9M_AAA	8.07e-33	39	355	56	359	ChainAAA, Peroxiredoxin [Clostridioides difficile 630]
1ITX_A	6.47e-31	41	352	22	406	ChainA, Glycosyl Hydrolase [Niallia circulans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P20533	2.41e-29	41	352	54	438	Chitinase A1 OS=Niallia circulans OX=1397 GN=chiA1 PE=1 SV=1
P32470	1.47e-26	34	348	34	379	Chitinase 1 OS=Aphanocladium album OX=12942 GN=CHI1 PE=1 SV=2
C5P230	2.11e-26	58	352	65	383	Endochitinase 1 OS=Coccidioides posadasii (strain C735) OX=222929 GN=CTS1 PE=3 SV=1
Q1E3R8	1.02e-25	58	352	65	383	Endochitinase 1 OS=Coccidioides immitis (strain RS) OX=246410 GN=CTS1 PE=3 SV=1
P0CB51	1.02e-25	58	352	65	383	Endochitinase 1 OS=Coccidioides posadasii (strain RMSCC 757 / Silveira) OX=443226 GN=CTS1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999887	0.000155	0.000018	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003564_00307.