CAZyme Information: MGYG000003565_01237

Basic Information

• Species: UBA3388 sp004551865
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; P3; UBA3388; UBA3388 sp004551865
• CAZyme ID: MGYG000003565_01237
• CAZy Family: GH2
• CAZyme Description: Evolved beta-galactosidase subunit alpha

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1056		121022.53	6.2593

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003565	1967680	MAG	Fiji	Oceania

• Gene Location: Start: 2552; End: 5722 Strand: -

Full Sequence      

MKQGVLQTSSRSTKARLLINVLFVLIVQSLSAQSTNDWENQRVFAINRTAHRATFVPYES
TAEMQSDEAYNYPWLMSHSNSYLSLNGQWQFVFASSPDKRPTQEDIFNSAQLNWQTINVP
SCWEMYAYDKPLYVNVEYPFDNNPPYINVKQQYKGQYADNPVGTYLKHFSLPSKWQGKRV
FLHFDGIYGAAYVMCNGKTVGYCQAGNNDAEFELTNYLREGDNTLCVQVIRWSDAAYLEG
QDIFHMSGLHRDVYLYAVEPIYISNHYIHSTLCAESNYTSGTLSIELSADNPTKSKIAKQ
YQVELLSPSGQTIWKQTKKVRLSSGDNTIFFESDTLSLLKPWSSETPNLYTVIIRQQDSK
GREELVFSTKHGFRQIEIKDNYVFINGKQVFFKGVNTQDTHPLRGRSIDVNTMLSDIIMM
KQANINTIRTSHYPRQPKMYAMTDYYGIYVMDEADVECHYNWVVGGEQGGITNDTTWTAQ
FVDRTTAMVLRDRNHPSIIFWSLGNESGGGENFRHTYNAVAALDTRPIHYEGATRGGTTH
TDLWSDMYPHLNTLIYYTTNDTLKKPYFMCEYAHAMGNAIGNLQDYWDEIEKGRNAIGGC
IWDWVDQAIYFPQAIKDNTLSKNGFAYYASGYDFPGPHQGNFLNNGILRADRKWNDKLSE
VKQVYSYVKFLSFDTLTNTLTLLNKYDFTNLDQFYLEFAISQDGYEISQDTLTLCSTAPD
DTLRLFVPIKSDFDKTKECFLNLQIKQRTANSWSRRSYTVAKAQFPLNAFEKATFSKPKS
EDAFDVNETSDTLCLKSSNIEIAFDKQSGDILFWKYRDCDVIASEAGSPRYNNNRWIEND
RSGDSLSGNISSHCQINISEDKTMATIRVATRSQKCDNTLEYKIYPCGVVDLSVILSPKT
ADLRRLGIGMTFADGFEQIEYFAKGPWENYWDRQQGSFVGRYATSVSEMFVPYAHPQSCG
NRTGMREVSLYDKTYTKGIKIEADRPISFSMLHYDDTDFAKEVLHTWDLKPHKEVFAHFD
YLQRGLGNGSCGPQTIEKYHVPSSGTYTFSLRFYPL

Enzyme Prediction     

No EC number prediction in MGYG000003565_01237.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	76	939	2.4e-185	0.9680851063829787

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK09525	lacZ	0.0	36	1053	15	1024	beta-galactosidase.
PRK10340	ebgA	0.0	36	1041	2	986	cryptic beta-D-galactosidase subunit alpha; Reviewed
COG3250	LacZ	3.92e-128	84	937	14	804	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
pfam02836	Glyco_hydro_2_C	2.30e-83	376	670	1	302	Glycosyl hydrolases family 2, TIM barrel domain. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.
pfam02929	Bgal_small_N	9.72e-62	796	1053	1	230	Beta galactosidase small chain. This domain comprises the small chain of dimeric beta-galactosidases EC:3.2.1.23. This domain is also found in single chain beta-galactosidase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ATS10900.1	0.0	38	1056	47	1068
ATS03704.1	0.0	38	1056	47	1068
QUI90955.1	0.0	38	1056	47	1068
QUI89009.1	0.0	38	1056	47	1068
ATS09286.1	0.0	38	1056	47	1068

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6S6Z_A	1.18e-180	37	1052	3	980	Structureof beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_B Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_C Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_D Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_E Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_F Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_G Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_H Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8]
6SD0_A	1.21e-180	37	1052	4	981	Structureof beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8],6SD0_B Structure of beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8],6SD0_C Structure of beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8],6SD0_D Structure of beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8]
3DEC_A	7.89e-170	37	1056	6	997	ChainA, Beta-galactosidase [Bacteroides thetaiotaomicron VPI-5482]
3BGA_A	1.90e-165	33	1056	5	1001	Crystalstructure of beta-galactosidase from Bacteroides thetaiotaomicron VPI-5482 [Bacteroides thetaiotaomicron VPI-5482],3BGA_B Crystal structure of beta-galactosidase from Bacteroides thetaiotaomicron VPI-5482 [Bacteroides thetaiotaomicron VPI-5482]
1PX3_A	2.27e-132	37	1051	15	1018	ChainA, beta-galactosidase [Escherichia coli],1PX3_B Chain B, beta-galactosidase [Escherichia coli],1PX3_C Chain C, beta-galactosidase [Escherichia coli],1PX3_D Chain D, beta-galactosidase [Escherichia coli],1PX4_A Chain A, beta-galactosidase [Escherichia coli],1PX4_B Chain B, beta-galactosidase [Escherichia coli],1PX4_C Chain C, beta-galactosidase [Escherichia coli],1PX4_D Chain D, beta-galactosidase [Escherichia coli]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q56307	6.61e-180	37	1052	4	981	Beta-galactosidase OS=Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) OX=243274 GN=lacZ PE=1 SV=2
O52847	5.35e-174	37	1056	19	1034	Beta-galactosidase OS=Priestia megaterium (strain DSM 319 / IMG 1521) OX=592022 GN=bgaM PE=3 SV=1
P81650	7.83e-138	37	1051	12	1031	Beta-galactosidase OS=Pseudoalteromonas haloplanktis OX=228 GN=lacZ PE=1 SV=2
P06864	1.32e-135	36	1041	2	986	Evolved beta-galactosidase subunit alpha OS=Escherichia coli (strain K12) OX=83333 GN=ebgA PE=1 SV=4
B1LIM9	3.12e-135	37	1051	16	1019	Beta-galactosidase OS=Escherichia coli (strain SMS-3-5 / SECEC) OX=439855 GN=lacZ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.001039	0.998219	0.000288	0.000149	0.000150	0.000151

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003565_01237.