CAZyme Information: MGYG000003565_01439

Basic Information

• Species: UBA3388 sp004551865
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; P3; UBA3388; UBA3388 sp004551865
• CAZyme ID: MGYG000003565_01439
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
652	MGYG000003565_51|CGC1	74051.3	8.3166

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003565	1967680	MAG	Fiji	Oceania

• Gene Location: Start: 26514; End: 28472 Strand: -

Full Sequence      

MKLSVVIVNYNVKFFLEHCLYSVQRAVADIDAEVFIVDNNSVDGSVQMLKSKFPDFTLIE
NKENVGFAKANNQAMRIAKGEYILLLNPDTVVEEDTFSKCIEFMDFHPDCGGLGVKMIDG
HGKILKESKRGFPTPWASFCKMSGLTSLFPHSKRYAQYYMGHLSYEETNQVDILAGAYMM
MRKECLDKVGLLDEDYFMYGEDIDLSYRITLGGYKNYYFPEAEIIHYKGESTKKASLNYV
YTFYNAMAIFARKHLDGRQNKIYSLIIKIAIWLRASLSFVSRIFSRWSQVAVDFLLIYAG
FFLLERTWALHYWGNIDYYPPHYMICAVPVYILILLFSVYVCGGYVKPIRIGRLFEGVFL
GMFVLLAFYSLLPAELRYSRALVVMGSVMSLCVLLLVRFVINFVRRGSFSFASSQPSRYA
IVADSPEAERVADLLSKTGNRPEFIALVGAAKEYDNDKFVGNTSQIEDIIRIYSIDEVVF
CSKDLTQSKIGELMGRLSKTNVCFTIVPPSADFIIGSSTIKTPSDLYLVNVNSITSEDNR
RKKRLLDVSVSLVLLLGFVGCCWFVNKPLGLLKNIFLVLIGRKTWVGYNKTGKEKIDKLP
DLKRSVISITGTMNAEIVDENAIHKLNLLYCANYSLMNDFGAICKSFRYLGD

Enzyme Prediction     

No EC number prediction in MGYG000003565_01439.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	4	189	3.3e-24	0.9882352941176471

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd04186	GT_2_like_c	4.11e-58	5	227	1	165	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
COG1216	GT2	4.62e-57	1	284	3	279	Glycosyltransferase, GT2 family [Carbohydrate transport and metabolism].
pfam00535	Glycos_transf_2	6.52e-22	4	109	1	108	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.
cd02525	Succinoglycan_BP_ExoA	5.99e-20	4	254	3	234	ExoA is involved in the biosynthesis of succinoglycan. Succinoglycan Biosynthesis Protein ExoA catalyzes the formation of a beta-1,3 linkage of the second sugar (glucose) of the succinoglycan with the galactose on the lipid carrie. Succinoglycan is an acidic exopolysaccharide that is important for invasion of the nodules. Succinoglycan is a high-molecular-weight polymer composed of repeating octasaccharide units. These units are synthesized on membrane-bound isoprenoid lipid carriers, beginning with galactose followed by seven glucose molecules, and modified by the addition of acetate, succinate, and pyruvate. ExoA is a membrane protein with a transmembrance domain at c-terminus.
cd04185	GT_2_like_b	9.34e-20	5	245	1	195	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QIA08556.1	8.15e-211	1	648	1	647
BBE19119.1	1.56e-207	1	651	1	646
QGY45414.1	1.44e-206	1	650	1	648
AEV32005.1	7.55e-204	1	651	1	651
CAG5084618.1	2.04e-202	1	650	1	651

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6P61_A	7.24e-07	4	127	16	142	Structureof a Glycosyltransferase from Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) [Leptospira borgpetersenii serovar Hardjo-bovis str. JB197],6P61_B Structure of a Glycosyltransferase from Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) [Leptospira borgpetersenii serovar Hardjo-bovis str. JB197],6P61_C Structure of a Glycosyltransferase from Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) [Leptospira borgpetersenii serovar Hardjo-bovis str. JB197],6P61_D Structure of a Glycosyltransferase from Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) [Leptospira borgpetersenii serovar Hardjo-bovis str. JB197]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P9WMY3	1.97e-17	3	257	5	266	N-acetylglucosaminyl-diphospho-decaprenol L-rhamnosyltransferase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=wbbL PE=1 SV=2
P9WMY2	1.97e-17	3	257	5	266	N-acetylglucosaminyl-diphospho-decaprenol L-rhamnosyltransferase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=wbbL PE=3 SV=2
O06483	3.94e-10	1	102	1	104	Uncharacterized glycosyltransferase YfnE OS=Bacillus subtilis (strain 168) OX=224308 GN=yfnE PE=3 SV=2
E0U4V7	1.57e-09	1	283	1	287	Poly(ribitol-phosphate) beta-glucosyltransferase OS=Bacillus spizizenii (strain ATCC 23059 / NRRL B-14472 / W23) OX=655816 GN=tarQ PE=1 SV=1
P36667	3.66e-09	66	260	61	254	Rhamnosyltransferase WbbL OS=Escherichia coli (strain K12) OX=83333 GN=wbbL PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000067	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
290	309
324	346
353	372
382	404
550	572