CAZyme Information: MGYG000003566_00508

Basic Information

• Species: F082 sp900769945
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; F082; F082; F082 sp900769945
• CAZyme ID: MGYG000003566_00508
• CAZy Family: GT4
• CAZyme Description: D-inositol-3-phosphate glycosyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
378	MGYG000003566_14|CGC1	42975.59	6.3125

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003566	1986649	MAG	Fiji	Oceania

• Gene Location: Start: 14732; End: 15868 Strand: +

Full Sequence      

MRIVIVGPSYPYRGGIAAFSERLAAEFVSEGDSVELVTFTLQYPSFLFPGKTQYSESPAA
PQKMEISRLVNSVIPTNWIKTGKIIREKNPDIVIFAYWMSFFAPCYGTIARVVKKSKNIR
CLALVHNMVPHEKSLIDKLLPPFFVKSMDGFVTLSKAVLSDVESLDNQDKPKIFTPHPLY
DNFGDIVPREDALSFLHIQDDCRYMLFFGLVRAYKGLDLLIEAFADTRFDTLPVKLVIAG
EFYDDMRHYLEMIDSHNLKDKVIIRDSYIPDEEVRYYFSAADIVVQPYKSATQSGVTQVA
YHFNRPMLVTDVGGLKEIVPDGVAGYVVEPRPESIADALVDFFGHGRLEPLVNNVREEKK
RYSWSNITQGIKKMLDIQ

Enzyme Prediction     

No EC number prediction in MGYG000003566_00508.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT4	201	347	1.4e-20	0.90625

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd03822	GT4_mannosyltransferase-like	1.53e-46	2	375	1	356	mannosyltransferases of glycosyltransferase family 4 and similar proteins. This family is most closely related to the GT1 family of glycosyltransferases. ORF704 in E. coli has been shown to be involved in the biosynthesis of O-specific mannose homopolysaccharides.
cd03801	GT4_PimA-like	1.27e-34	2	375	1	365	phosphatidyl-myo-inositol mannosyltransferase. This family is most closely related to the GT4 family of glycosyltransferases and named after PimA in Propionibacterium freudenreichii, which is involved in the biosynthesis of phosphatidyl-myo-inositol mannosides (PIM) which are early precursors in the biosynthesis of lipomannans (LM) and lipoarabinomannans (LAM), and catalyzes the addition of a mannosyl residue from GDP-D-mannose (GDP-Man) to the position 2 of the carrier lipid phosphatidyl-myo-inositol (PI) to generate a phosphatidyl-myo-inositol bearing an alpha-1,2-linked mannose residue (PIM1). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in certain bacteria and archaea.
COG0438	RfaB	5.89e-31	1	376	1	375	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].
cd03809	GT4_MtfB-like	7.58e-23	2	369	1	358	glycosyltransferases MtfB, WbpX, and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases. MtfB (mannosyltransferase B) in E. coli has been shown to direct the growth of the O9-specific polysaccharide chain. It transfers two mannoses into the position 3 of the previously synthesized polysaccharide.
cd03811	GT4_GT28_WabH-like	9.08e-22	2	341	1	323	family 4 and family 28 glycosyltransferases similar to Klebsiella WabH. This family is most closely related to the GT1 family of glycosyltransferases. WabH in Klebsiella pneumoniae has been shown to transfer a GlcNAc residue from UDP-GlcNAc onto the acceptor GalUA residue in the cellular outer core.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADQ79882.1	5.59e-154	1	371	1	369
QCR23210.1	1.40e-141	2	371	4	373
AMR27140.1	1.67e-141	1	377	1	376
AMJ66574.1	5.48e-140	1	377	1	376
QNP51022.1	7.26e-140	1	372	1	370

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5D00_A	3.18e-07	10	338	13	332	Crystalstructure of BshA from B. subtilis complexed with N-acetylglucosaminyl-malate and UMP [Bacillus subtilis subsp. subtilis str. 168],5D00_B Crystal structure of BshA from B. subtilis complexed with N-acetylglucosaminyl-malate and UMP [Bacillus subtilis subsp. subtilis str. 168],5D01_A Crystal structure of BshA from B. subtilis complexed with N-acetylglucosaminyl-malate [Bacillus subtilis subsp. subtilis str. 168],5D01_B Crystal structure of BshA from B. subtilis complexed with N-acetylglucosaminyl-malate [Bacillus subtilis subsp. subtilis str. 168]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
D4GU66	1.08e-19	176	369	174	362	Low-salt glycan biosynthesis hexosyltransferase Agl5 OS=Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2) OX=309800 GN=agl5 PE=3 SV=1
Q59002	8.15e-16	1	369	1	375	Uncharacterized glycosyltransferase MJ1607 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) OX=243232 GN=MJ1607 PE=3 SV=1
Q58577	4.37e-13	1	376	4	347	Uncharacterized glycosyltransferase MJ1178 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) OX=243232 GN=MJ1178 PE=3 SV=1
D5UJ42	1.20e-11	189	377	245	438	D-inositol 3-phosphate glycosyltransferase OS=Cellulomonas flavigena (strain ATCC 482 / DSM 20109 / BCRC 11376 / JCM 18109 / NBRC 3775 / NCIMB 8073 / NRS 134) OX=446466 GN=mshA PE=3 SV=1
P26470	7.54e-10	188	375	179	375	Lipopolysaccharide 1,2-N-acetylglucosaminetransferase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=waaK PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000059	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003566_00508.