CAZyme Information: MGYG000003567_00535

Basic Information

• Species: Spiro-01 sp900769955
• Lineage: Bacteria; Spirochaetota; Spirochaetia; Sphaerochaetales; Sphaerochaetaceae; Spiro-01; Spiro-01 sp900769955
• CAZyme ID: MGYG000003567_00535
• CAZy Family: CE8
• CAZyme Description: Pectinesterase A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
284		31847.94	6.2472

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003567	2372143	MAG	Fiji	Oceania

• Gene Location: Start: 13824; End: 14678 Strand: +

Full Sequence      

MSERFELTVSKDGNGSYMTIQEALNAVPYMVPATITVKEGIYREKLFSDKHDLIIRGEGK
VFITYDDSARELLSDGKKRGTFRSYTAFFSGEKLHLENLTIQNSAGRGCDAGQAVALYLD
VSESYLKDVNLLGHQDTLFLAPLPDEEREVRGFYGPRCFSPRRRTRTLFEGGSISGGVDF
IFGGGDAVFRDAEIISVEKGFVTAPSGKKDWDGFTFENCRFTSPLSLIGEVYLMRPWRDE
AKARFVKCTFSHHINRDGFIPWTGRADKAHLSSFSMEGCTFSDL

Enzyme Prediction     

No EC number prediction in MGYG000003567_00535.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE8	7	268	6.6e-62	0.8472222222222222

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4677	PemB	8.78e-45	5	262	81	358	Pectin methylesterase and related acyl-CoA thioesterases [Carbohydrate transport and metabolism, Lipid transport and metabolism].
pfam01095	Pectinesterase	6.56e-40	8	264	3	247	Pectinesterase.
PLN02708	PLN02708	3.26e-36	8	264	244	498	Probable pectinesterase/pectinesterase inhibitor
PLN02990	PLN02990	1.91e-28	9	264	263	507	Probable pectinesterase/pectinesterase inhibitor
PLN02773	PLN02773	3.05e-26	7	280	7	266	pectinesterase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADY12911.1	1.00e-96	7	283	4	280
CBK98674.1	2.18e-77	7	275	4	276
AXA81880.1	6.17e-77	7	275	4	276
AXB27671.1	5.77e-76	7	280	4	281
CBL01447.1	5.77e-76	7	280	4	281

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1XG2_A	5.39e-19	9	264	7	250	ChainA, Pectinesterase 1 [Solanum lycopersicum]
2NSP_A	9.70e-19	10	206	12	211	ChainA, Pectinesterase A [Dickeya dadantii 3937],2NSP_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NST_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NST_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT6_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT6_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT9_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT9_B Chain B, Pectinesterase A [Dickeya dadantii 3937]
5C1C_A	1.12e-18	7	269	11	252	CrystalStructure of the Pectin Methylesterase from Aspergillus niger in Deglycosylated Form [Aspergillus niger ATCC 1015]
5C1E_A	5.51e-18	7	269	11	252	CrystalStructure of the Pectin Methylesterase from Aspergillus niger in Penultimately Deglycosylated Form (N-acetylglucosamine Stub at Asn84) [Aspergillus niger ATCC 1015]
1QJV_A	1.97e-16	10	206	12	211	ChainA, PECTIN METHYLESTERASE [Dickeya chrysanthemi],1QJV_B Chain B, PECTIN METHYLESTERASE [Dickeya chrysanthemi]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9LXD9	2.80e-25	6	264	240	496	Probable pectinesterase/pectinesterase inhibitor 51 OS=Arabidopsis thaliana OX=3702 GN=PME51 PE=2 SV=1
Q8GXA1	1.02e-24	9	264	260	504	Probable pectinesterase/pectinesterase inhibitor 23 OS=Arabidopsis thaliana OX=3702 GN=PME23 PE=2 SV=3
Q9FJ21	2.22e-23	7	264	260	506	Probable pectinesterase/pectinesterase inhibitor 58 OS=Arabidopsis thaliana OX=3702 GN=PME58 PE=2 SV=1
Q8L7Q7	7.99e-23	6	264	288	547	Probable pectinesterase/pectinesterase inhibitor 64 OS=Arabidopsis thaliana OX=3702 GN=PME64 PE=2 SV=2
O49298	9.83e-23	6	264	250	489	Probable pectinesterase/pectinesterase inhibitor 6 OS=Arabidopsis thaliana OX=3702 GN=PME6 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000064	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003567_00535.