CAZyme Information: MGYG000003567_01249

Basic Information

• Species: Spiro-01 sp900769955
• Lineage: Bacteria; Spirochaetota; Spirochaetia; Sphaerochaetales; Sphaerochaetaceae; Spiro-01; Spiro-01 sp900769955
• CAZyme ID: MGYG000003567_01249
• CAZy Family: GH28
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
425	MGYG000003567_152|CGC1	47312.14	5.1979

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003567	2372143	MAG	Fiji	Oceania

• Gene Location: Start: 8185; End: 9462 Strand: -

Full Sequence      

MTGIMNAYGDGLRDDTKAIQEALDKRGLVIFESGKTYLSSSLIIHSDTTLYFEPGSKLKA
SEDINTYIHPAEVDNDETRGVGTPVTRKPAFVFLYALGEKNITIEGDGEISGSCDAFLTN
VTKYHRDAPIYPRPTMIYFENCRNLKFRGITLKDAPFWTLHTAGCDNVLVDGVTIDNPLD
AANSDGIDPDHSRNVRIVNSSIACADDCIVLKNCNGNNEYHNTKDVIISNCHLISTSAAL
KIGTEGVDDFENVLVENCIIESSNRGISIQVRDKGNVRNVHFRNILIETRRFSHQWWGSA
EPIAITTYNRDTNTDSGIIEDVTFENITATCENGIFIDAEESKIRNILLRNVKVHLVKKS
KWATTGHDMRPKYNEPMYTEEKVGALSARNVSGLKLENFSYVIDAHENFAPEYPVKLANT
SIVTC

Enzyme Prediction     

No EC number prediction in MGYG000003567_01249.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH28	31	365	4.3e-69	0.8984615384615384

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG5434	Pgu1	7.91e-44	7	323	90	424	Polygalacturonase [Carbohydrate transport and metabolism].
pfam00295	Glyco_hydro_28	7.41e-23	103	360	62	309	Glycosyl hydrolases family 28. Glycosyl hydrolase family 28 includes polygalacturonase EC:3.2.1.15 as well as rhamnogalacturonase A(RGase A), EC:3.2.1.-. These enzymes are important in cell wall metabolism.
PLN02793	PLN02793	3.82e-22	7	354	60	394	Probable polygalacturonase
PLN02218	PLN02218	3.73e-18	7	354	75	408	polygalacturonase ADPG
PLN03003	PLN03003	4.11e-18	100	354	113	357	Probable polygalacturonase At3g15720

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AXB29249.1	3.10e-103	7	398	10	412
CBL02678.1	4.38e-103	7	398	10	412
ANU45921.1	1.52e-100	7	407	10	416
QQQ99325.1	1.52e-100	7	407	10	416
QIX90756.1	2.41e-99	7	407	10	416

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5OLP_A	7.39e-14	7	245	52	312	Galacturonidase[Bacteroides thetaiotaomicron VPI-5482],5OLP_B Galacturonidase [Bacteroides thetaiotaomicron VPI-5482]
3JUR_A	6.84e-10	7	212	35	266	Thecrystal structure of a hyperthermoactive Exopolygalacturonase from Thermotoga maritima [Thermotoga maritima],3JUR_B The crystal structure of a hyperthermoactive Exopolygalacturonase from Thermotoga maritima [Thermotoga maritima],3JUR_C The crystal structure of a hyperthermoactive Exopolygalacturonase from Thermotoga maritima [Thermotoga maritima],3JUR_D The crystal structure of a hyperthermoactive Exopolygalacturonase from Thermotoga maritima [Thermotoga maritima]
1BHE_A	9.67e-09	16	245	26	258	ChainA, POLYGALACTURONASE [Pectobacterium carotovorum]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A7PZL3	1.40e-16	9	249	72	321	Probable polygalacturonase OS=Vitis vinifera OX=29760 GN=GSVIVT00026920001 PE=1 SV=1
Q8RY29	1.59e-11	7	212	75	270	Polygalacturonase ADPG2 OS=Arabidopsis thaliana OX=3702 GN=ADPG2 PE=2 SV=2
Q02096	3.06e-11	7	212	92	284	Polygalacturonase OS=Persea americana OX=3435 PE=2 SV=1
O23147	4.90e-10	7	212	75	270	Polygalacturonase ADPG1 OS=Arabidopsis thaliana OX=3702 GN=ADPG1 PE=2 SV=1
P27644	1.62e-09	137	249	25	145	Polygalacturonase OS=Rhizobium radiobacter OX=358 GN=pgl PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000054	0.000003	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003567_01249.