CAZyme Information: MGYG000003567_02216

Basic Information

• Species: Spiro-01 sp900769955
• Lineage: Bacteria; Spirochaetota; Spirochaetia; Sphaerochaetales; Sphaerochaetaceae; Spiro-01; Spiro-01 sp900769955
• CAZyme ID: MGYG000003567_02216
• CAZy Family: GH3
• CAZyme Description: Thermostable beta-glucosidase B

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
514		56654.3	5.4009

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003567	2372143	MAG	Fiji	Oceania

• Gene Location: Start: 11375; End: 12919 Strand: +

Full Sequence      

MRDIEALVKEMTTEEKCSLLSGLDMWHTKPVERLGIPSVMVSDGPNGLRKQAEKGDIIGI
NSAVTAVCFPTGSAVASTFDRKLLRSLGSALGTAARAEGVHTLLGPAINMKRSPLCGRNF
EYMSEDPYLAGELAAEYTLGVQSHGVGVSVKHFAANNQEYSRMSTDTIVSERALREIYLC
AFERVVKKASPWTVMCSYNRINGKYSSENRWLLTDVLRSEWGFDGIVMTDWSAINHRDEA
LEAGLELEMPSSYGIRDRQIVKAVKEGKVKEEVLDEAVRRLLSWIFRDSSDSNPVTYSLD
EHHEMAKRIAWEAAVLLKNNNASLPLKDDEKVLFVGSYAKHARYQGGGSSHVSSYKVTSF
LDGLDVPFEMGWSEDGFTRDADALDRVIAKAGKYDKTVIFAGLPDSYESEGVDRKHMMLP
PCQDELISEVTKVCDSVIVVLSSGSPVAMPWAEDVSSILQLHLGGEASGEACRDIIYGKV
NPSGHLAETYPLRLEDNPSYLSFPGSGKKVVYIK

Enzyme Prediction     

No EC number prediction in MGYG000003567_02216.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	31	250	6.8e-67	0.9814814814814815

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1472	BglX	5.58e-73	33	352	57	373	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
PLN03080	PLN03080	6.34e-60	6	498	55	597	Probable beta-xylosidase; Provisional
pfam01915	Glyco_hydro_3_C	5.73e-54	314	499	1	198	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
PRK15098	PRK15098	2.85e-47	69	508	120	617	beta-glucosidase BglX.
pfam00933	Glyco_hydro_3	2.04e-38	33	283	63	315	Glycosyl hydrolase family 3 N terminal domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCO21793.1	2.22e-225	3	512	4	516
QCU03756.1	3.70e-208	2	512	3	516
BCJ98203.1	1.19e-203	3	512	2	515
BCN32796.1	3.86e-202	3	512	5	528
CBL13852.1	3.56e-199	1	512	1	516

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7MS2_A	9.88e-191	3	512	4	522	ChainA, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
5WAB_A	3.62e-150	8	512	9	520	CrystalStructure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_B Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_C Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_D Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703]
2X40_A	6.36e-105	1	512	1	572	Structureof beta-glucosidase 3B from Thermotoga neapolitana in complex with glycerol [Thermotoga neapolitana DSM 4359],2X41_A Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glucose [Thermotoga neapolitana DSM 4359]
2X42_A	9.67e-104	1	512	1	572	Structureof beta-glucosidase 3B from Thermotoga neapolitana in complex with alpha-D-glucose [Thermotoga neapolitana DSM 4359]
3AC0_A	1.14e-95	3	512	5	692	Crystalstructure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_B Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_C Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_D Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P14002	5.41e-190	3	512	4	522	Thermostable beta-glucosidase B OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=bglB PE=1 SV=2
E7CY69	9.28e-146	8	512	9	529	Exo-alpha-(1->6)-L-arabinopyranosidase OS=Bifidobacterium longum OX=216816 GN=apy PE=1 SV=1
F6C6C1	4.11e-144	8	512	9	529	Exo-alpha-(1->6)-L-arabinopyranosidase OS=Bifidobacterium breve (strain ACS-071-V-Sch8b) OX=866777 GN=HMPREF9228_1477 PE=1 SV=1
A1DFA8	1.14e-105	3	512	5	679	Probable beta-glucosidase I OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=bglI PE=3 SV=1
Q2U8Y5	1.16e-105	3	512	5	679	Probable beta-glucosidase I OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=bglI PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000021	0.000005	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003567_02216.