CAZyme Information: MGYG000003569_02493

Basic Information

• Species: Treponema_D sp900769975
• Lineage: Bacteria; Spirochaetota; Spirochaetia; Treponematales; Treponemataceae; Treponema_D; Treponema_D sp900769975
• CAZyme ID: MGYG000003569_02493
• CAZy Family: GT4
• CAZyme Description: Glycosyltransferase Gtf1

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
362		41670.23	8.7945

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003569	3076540	MAG	Fiji	Oceania

• Gene Location: Start: 13695; End: 14783 Strand: +

Full Sequence      

MEILFAHLLNNFTGSPKVLSVLLKSLSNDSNLKISLLTSKTDGILNDIPNVEYHDNFYRW
HENKILRIFQFSLAQIRNFFFTLFADFDILYMNTVVPFGAALAARLRGKKIIYHIHEVYI
NPGFLKRFYSKVMKKCASEVICVSKYVQEHADFLPSVVVYNPIEFSPLPENFDEYLNEKL
KRKIIFMPTSLKEYKGVFQFVELARKNSDYNFVLLCSTELSEMQKIFAKIDLPGNLTLVG
KQKSLEKFYREASVTMNLSLYDKFIETFGLTVLESFDALVPAVAPAYGGPKEIIENGKNG
FLINPYNLDEISERIKRITSSFDVYKTFALNAKNRAKDFSEDNFFSGVKNVIQDIAKEES
KK

Enzyme Prediction     

No EC number prediction in MGYG000003569_02493.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT4	177	321	1.1e-24	0.91875

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd03801	GT4_PimA-like	5.88e-30	3	342	4	355	phosphatidyl-myo-inositol mannosyltransferase. This family is most closely related to the GT4 family of glycosyltransferases and named after PimA in Propionibacterium freudenreichii, which is involved in the biosynthesis of phosphatidyl-myo-inositol mannosides (PIM) which are early precursors in the biosynthesis of lipomannans (LM) and lipoarabinomannans (LAM), and catalyzes the addition of a mannosyl residue from GDP-D-mannose (GDP-Man) to the position 2 of the carrier lipid phosphatidyl-myo-inositol (PI) to generate a phosphatidyl-myo-inositol bearing an alpha-1,2-linked mannose residue (PIM1). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in certain bacteria and archaea.
cd03811	GT4_GT28_WabH-like	5.62e-26	3	335	2	342	family 4 and family 28 glycosyltransferases similar to Klebsiella WabH. This family is most closely related to the GT1 family of glycosyltransferases. WabH in Klebsiella pneumoniae has been shown to transfer a GlcNAc residue from UDP-GlcNAc onto the acceptor GalUA residue in the cellular outer core.
cd03808	GT4_CapM-like	2.26e-25	61	342	52	351	capsular polysaccharide biosynthesis glycosyltransferase CapM and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases. CapM in Staphylococcus aureus is required for the synthesis of type 1 capsular polysaccharides.
cd03820	GT4_AmsD-like	1.44e-23	14	343	14	344	amylovoran biosynthesis glycosyltransferase AmsD and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases. AmSD in Erwinia amylovora has been shown to be involved in the biosynthesis of amylovoran, the acidic exopolysaccharide acting as a virulence factor. This enzyme may be responsible for the formation of galactose alpha-1,6 linkages in amylovoran.
COG0438	RfaB	2.07e-23	46	359	45	381	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEB13870.1	8.69e-237	1	355	1	355
AZA99340.1	5.31e-76	2	344	3	347
QBN17528.1	1.45e-75	1	344	1	346
AZA64345.1	2.64e-73	2	355	3	358
AZA49454.1	2.64e-73	2	355	3	358

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7EC2_A	8.86e-09	48	352	190	490	ChainA, Glycosyl transferase, group 1 family protein [Staphylococcus aureus subsp. aureus USA300],7EC2_B Chain B, Glycosyl transferase, group 1 family protein [Staphylococcus aureus subsp. aureus USA300]
3S28_A	1.48e-08	28	315	416	724	Thecrystal structure of sucrose synthase-1 in complex with a breakdown product of the UDP-glucose [Arabidopsis thaliana],3S28_B The crystal structure of sucrose synthase-1 in complex with a breakdown product of the UDP-glucose [Arabidopsis thaliana],3S28_C The crystal structure of sucrose synthase-1 in complex with a breakdown product of the UDP-glucose [Arabidopsis thaliana],3S28_D The crystal structure of sucrose synthase-1 in complex with a breakdown product of the UDP-glucose [Arabidopsis thaliana],3S28_E The crystal structure of sucrose synthase-1 in complex with a breakdown product of the UDP-glucose [Arabidopsis thaliana],3S28_F The crystal structure of sucrose synthase-1 in complex with a breakdown product of the UDP-glucose [Arabidopsis thaliana],3S28_G The crystal structure of sucrose synthase-1 in complex with a breakdown product of the UDP-glucose [Arabidopsis thaliana],3S28_H The crystal structure of sucrose synthase-1 in complex with a breakdown product of the UDP-glucose [Arabidopsis thaliana],3S29_A The crystal structure of sucrose synthase-1 from Arabidopsis thaliana and its functional implications. [Arabidopsis thaliana],3S29_B The crystal structure of sucrose synthase-1 from Arabidopsis thaliana and its functional implications. [Arabidopsis thaliana],3S29_C The crystal structure of sucrose synthase-1 from Arabidopsis thaliana and its functional implications. [Arabidopsis thaliana],3S29_D The crystal structure of sucrose synthase-1 from Arabidopsis thaliana and its functional implications. [Arabidopsis thaliana],3S29_E The crystal structure of sucrose synthase-1 from Arabidopsis thaliana and its functional implications. [Arabidopsis thaliana],3S29_F The crystal structure of sucrose synthase-1 from Arabidopsis thaliana and its functional implications. [Arabidopsis thaliana],3S29_G The crystal structure of sucrose synthase-1 from Arabidopsis thaliana and its functional implications. [Arabidopsis thaliana],3S29_H The crystal structure of sucrose synthase-1 from Arabidopsis thaliana and its functional implications. [Arabidopsis thaliana]
3S27_A	1.41e-07	28	315	416	724	Thecrystal structure of sucrose synthase-1 from Arabidopsis thaliana and its functional implications. [Arabidopsis thaliana],3S27_B The crystal structure of sucrose synthase-1 from Arabidopsis thaliana and its functional implications. [Arabidopsis thaliana],3S27_C The crystal structure of sucrose synthase-1 from Arabidopsis thaliana and its functional implications. [Arabidopsis thaliana],3S27_D The crystal structure of sucrose synthase-1 from Arabidopsis thaliana and its functional implications. [Arabidopsis thaliana],3S27_E The crystal structure of sucrose synthase-1 from Arabidopsis thaliana and its functional implications. [Arabidopsis thaliana],3S27_F The crystal structure of sucrose synthase-1 from Arabidopsis thaliana and its functional implications. [Arabidopsis thaliana],3S27_G The crystal structure of sucrose synthase-1 from Arabidopsis thaliana and its functional implications. [Arabidopsis thaliana],3S27_H The crystal structure of sucrose synthase-1 from Arabidopsis thaliana and its functional implications. [Arabidopsis thaliana]
2R60_A	1.52e-07	177	356	257	460	Structureof apo Sucrose Phosphate Synthase (SPS) of Halothermothrix orenii [Halothermothrix orenii],2R66_A Complex Structure of Sucrose Phosphate Synthase (SPS)-F6P of Halothermothrix orenii [Halothermothrix orenii H 168],2R68_A Complex Structure of Sucrose Phosphate Synthase (SPS)-S6P of Halothermothrix orenii [Halothermothrix orenii H 168]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q58577	4.32e-15	88	356	85	350	Uncharacterized glycosyltransferase MJ1178 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) OX=243232 GN=MJ1178 PE=3 SV=1
Q00917	1.54e-13	28	312	413	719	Sucrose synthase 2 OS=Arabidopsis thaliana OX=3702 GN=SUS2 PE=2 SV=3
P31924	3.71e-12	165	312	558	724	Sucrose synthase 1 OS=Oryza sativa subsp. japonica OX=39947 GN=SUS1 PE=1 SV=1
Q41608	2.76e-11	165	315	552	721	Sucrose synthase 1 OS=Tulipa gesneriana OX=13306 PE=2 SV=1
O24301	4.90e-11	170	313	559	724	Sucrose synthase 2 OS=Pisum sativum OX=3888 GN=SUS2 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000047	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003569_02493.