CAZyme Information: MGYG000003570_00668

Basic Information

• Species: Treponema_D sp900769985
• Lineage: Bacteria; Spirochaetota; Spirochaetia; Treponematales; Treponemataceae; Treponema_D; Treponema_D sp900769985
• CAZyme ID: MGYG000003570_00668
• CAZy Family: GH57
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
658		75737.45	6.1428

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003570	3193382	MAG	Fiji	Oceania

• Gene Location: Start: 123300; End: 125276 Strand: +

Full Sequence      

MINICLEFSTESSNFTDISDYKTVYEKMYKPLISFLYAHQECPFSFYFSGLEFDFIRQKN
PEFIEILRKLVNRKQVEILGGGYYNPVFPLLFPQDRTGQVELLSSAIRKSVGKRPRGVSL
CASAWDPSLVTSFETCGMEYVQLDSSLIPDDKNVFLPIVMADRGKSIKIISIQNEFIPKQ
NELPEDFIIRIKKAIEKKIKSSDFYQDADRVITISLTRYSVNTVLENNWLERFLELTVNQ
YSDDLKLSLPVNCVRNSKAFIQSYIHSGISSDIAKWVTEPFKEIEVKGSSVNIYDFMQTY
KRSQALYNRMIFVSLLVNNCHGDKMRKKAAREYLWAAQNGDAYVCKSSGILVSSQERQNA
YRKLTDAEKLVRECENFQESLTSFDYNCDGFKEYVCRMEKYNACITLLGGAIFELNVMKN
SGNYADNMSRIIPLDKCSDNYEKGLFVDHLFEPEEYENYINGRDCKNGVFSGNIYREINF
NSQKHEIFLETDSDFPSLNQTVNLKKKYVVTTNGIMVQYIIKNTSPIALKAKFVVESNFA
QTCFKINTFDSYKIEVVNNNQIEEKSPDNLEFMKNVDAFMLTDTDNNVSFTFEPNEMANL
VSYPIVFMRKKTDSKNLEPAGRTLSLSLAWDVNLSCGMEMEKTINLSIIPGRKKSRTS

Enzyme Prediction     

No EC number prediction in MGYG000003570_00668.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH57	25	363	4.2e-39	0.9268929503916449

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd10793	GH57N_TLGT_like	2.30e-38	14	250	14	250	N-terminal catalytic domain of 4-alpha-glucanotransferase; glycoside hydrolase family 57 (GH57). 4-alpha-glucanotransferase (TLGT, EC 2.4.1.25) plays a key role in the maltose metabolism. It catalyzes the disproportionation of amylose and the formation of large cyclic alpha-1,4-glucan (cycloamylose) from linear amylose. TLGT functions as a homodimer. Each monomer is composed of two domains, an N-terminal catalytic domain with a (beta/alpha)7 barrel fold and a C-terminal domain with a twisted beta-sandwich fold. Some family members have been designated as alpha-amylases, such as the heat-stable eubacterial amylase from Dictyoglomus thermophilum (DtAmyA) and the extremely thermostable archaeal amylase from Pyrococcus furiosus(PfAmyA). However, both of these proteins are 4-alpha-glucanotransferases. DtAmyA was shown to have transglycosylating activity and PfAmyA exhibits 4-alpha-glucanotransferase activity.
pfam03065	Glyco_hydro_57	4.44e-20	20	164	39	193	Glycosyl hydrolase family 57. This family includes alpha-amylase (EC:3.2.1.1), 4--glucanotransferase (EC:2.4.1.-) and amylopullulanase enzymes.
pfam09095	DUF1926	1.19e-13	385	605	1	244	Domain of unknown function (DUF1926). Members of this family, which are found in a set of prokaryotic transferases, adopt a beta-sandwich fold, in which two layers of anti-parallel beta-sheets are arranged in a nearly parallel fashion. The exact function of this family is, as yet, unknown, however it has been proposed that they may play a role in transglycosylation reactions.
cd10794	GH57N_PfGalA_like	4.06e-12	15	180	10	181	N-terminal catalytic domain of alpha-galactosidase; glycoside hydrolase family 57 (GH57). Alpha-galactosidases (GalA, EC 3.2.1.22) catalyze the hydrolysis of alpha-1,6-linked galactose residues from oligosaccharides and polymeric galactomannans. Based on sequence similarity, the majority of eukaryotic and bacterial GalAs have been classified into glycoside hydrolase family GH27, GH36, and GH4, respectively. This subfamily is represented by a novel type of GalA from Pyrococcus furiosus (PfGalA), which belongs to the GH57 family. PfGalA is an extremely thermo-active and thermostable GalA that functions as a bacterial-like GalA, however, without the capacity to hydrolyze polysaccharides. It specifically catalyzes the hydrolysis of para-nitrophenyl-alpha-galactopyranoside, and to some extent that of melibiose and raffinose. PfGalA has a pH optimum between 5.0-5.5.
cd01022	GH57N_like	2.23e-10	24	149	27	167	N-terminal catalytic domain of heat stable retaining glycoside hydrolase family 57. Glycoside hydrolase family 57(GH57) is a chiefly prokaryotic family with the majority of thermostable enzymes coming from extremophiles (many of these are archaeal hyperthermophiles), which exhibit the enzyme specificities of alpha-amylase (EC 3.2.1.1), 4-alpha-glucanotransferase (EC 2.4.1.25), amylopullulanase (EC 3.2.1.1/41), and alpha-galactosidase (EC 3.2.1.22). This family also includes many hypothetical proteins with uncharacterized activity and specificity. GH57s cleave alpha-glycosidic bonds by employing a retaining mechanism, which involves a glycosyl-enzyme intermediate, allowing transglycosylation.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QTQ11807.1	4.43e-209	2	658	4	660
QTQ16225.1	1.26e-208	2	658	4	660
QTQ14015.1	5.06e-208	2	658	4	660
QSI02287.1	5.49e-201	1	656	3	663
QNL97410.1	2.78e-181	4	654	4	664

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1K1X_A	8.72e-26	21	430	23	438	Crystalstructure of 4-alpha-glucanotransferase from thermococcus litoralis [Thermococcus litoralis],1K1X_B Crystal structure of 4-alpha-glucanotransferase from thermococcus litoralis [Thermococcus litoralis],1K1Y_A Crystal structure of thermococcus litoralis 4-alpha-glucanotransferase complexed with acarbose [Thermococcus litoralis],1K1Y_B Crystal structure of thermococcus litoralis 4-alpha-glucanotransferase complexed with acarbose [Thermococcus litoralis]
1K1W_A	1.07e-23	21	430	23	438	Crystalstructure of 4-alpha-glucanotransferase from thermococcus litoralis [Thermococcus litoralis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P09961	1.57e-35	25	430	28	450	Alpha-amylase 1 OS=Dictyoglomus thermophilum (strain ATCC 35947 / DSM 3960 / H-6-12) OX=309799 GN=amyA PE=1 SV=2
O57932	6.04e-28	22	475	24	497	Alpha-amylase OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) OX=70601 GN=amyA PE=3 SV=1
O32450	1.17e-27	22	540	24	573	4-alpha-glucanotransferase OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) OX=69014 GN=TK1809 PE=3 SV=1
Q9V298	3.64e-26	25	540	27	575	Alpha-amylase OS=Pyrococcus abyssi (strain GE5 / Orsay) OX=272844 GN=amyA PE=3 SV=1
P49067	1.48e-25	21	430	24	439	Alpha-amylase OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) OX=186497 GN=amyA PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000053	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003570_00668.