CAZyme Information: MGYG000003570_01274

Basic Information

• Species: Treponema_D sp900769985
• Lineage: Bacteria; Spirochaetota; Spirochaetia; Treponematales; Treponemataceae; Treponema_D; Treponema_D sp900769985
• CAZyme ID: MGYG000003570_01274
• CAZy Family: GH18
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
366	MGYG000003570_115|CGC2	41750.95	8.3289

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003570	3193382	MAG	Fiji	Oceania

• Gene Location: Start: 36437; End: 37537 Strand: +

Full Sequence      

MKKISPLKKAFALNLIFSICMLSGFTETKQYPKVTQKTVTEDGVMFPGYSHPYKWNDEIK
GDPVLFDEVWGYVMMSRLKDYDENTPLTDIGLFAAEVNCYGELVNIPPRNAIGPKFKGRV
HLVTICESTSLSHFCIDASYGHRDKIIKDLLTAVKDFDGLQVDWELIPARDADNFLSFLK
ELKAGLGDKPLTVCVPARIKTLEKDVYDYKKIGKIADRIMIMAYDEHWTKGPAGSIASYN
WCEKIANYAKTVWPANKYILGLPFYGRTWGSEPVTRAWAFNGMNRLAHENNVIKIERENG
IPHYTYKTEVTVTGWYEDAHSNVIRSRMYQSKGYNNIAFWRMGQEDCAVWEWIGNKTSGT
KPLGSK

Enzyme Prediction     

No EC number prediction in MGYG000003570_01274.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH18	139	346	5.7e-35	0.6959459459459459

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd02874	GH18_CFLE_spore_hydrolase	1.82e-46	83	351	21	311	Cortical fragment-lytic enzyme (CFLE) is a peptidoglycan hydrolase involved in bacterial endospore germination. CFLE is expressed as an inactive preprotein (called SleB) in the forespore compartment of sporulating cells. SleB translocates across the forespore inner membrane and is deposited as a mature enzyme in the cortex layer of the spore. As part of a sensory mechanism capable of initiating germination, CFLE degrades a spore-specific peptidoglycan constituent called muramic-acid delta-lactam that comprises the outer cortex. CFLE has a C-terminal glycosyl hydrolase family 18 (GH18) catalytic domain as well as two N-terminal LysM peptidoglycan-binding domains. In addition to SleB, this family includes YaaH, YdhD, and YvbX from Bacillus subtilis.
COG3858	YaaH	9.43e-36	143	356	192	421	Spore germination protein YaaH [Cell cycle control, cell division, chromosome partitioning].
cd06549	GH18_trifunctional	9.36e-27	143	350	89	298	GH18 domain of an uncharacterized family of bacterial proteins, which share a common three-domain architecture: an N-terminal glycosyl hydrolase family 18 (GH18) domain, a glycosyl transferase family 2 domain, and a C-terminal polysaccharide deacetylase domain.
pfam00704	Glyco_hydro_18	7.26e-22	142	344	88	306	Glycosyl hydrolases family 18.
smart00636	Glyco_18	5.81e-19	142	344	91	333	Glyco_18 domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QTQ14800.1	1.27e-136	32	353	68	387
QTQ11038.1	1.79e-136	32	353	99	418
QTQ17017.1	1.79e-136	32	353	99	418
AEB15386.1	1.62e-104	64	351	23	312
QNL96450.1	1.04e-100	36	353	39	349

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4S3K_A	1.77e-15	143	361	197	431	ChainA, Spore germination protein YaaH [Priestia megaterium QM B1551]
3CZ8_A	3.13e-14	88	342	34	308	ChainA, Putative sporulation-specific glycosylase ydhD [Bacillus subtilis subsp. subtilis str. 168],3CZ8_B Chain B, Putative sporulation-specific glycosylase ydhD [Bacillus subtilis subsp. subtilis str. 168]
4Q6T_A	7.25e-14	147	350	102	332	Thecrystal structure of a class V chitininase from Pseudomonas fluorescens Pf-5 [Pseudomonas protegens Pf-5]
5JH8_A	2.50e-13	139	350	85	307	Crystalstructure of chitinase from Chromobacterium violaceum ATCC 12472 [Chromobacterium violaceum ATCC 12472]
6G9C_A	6.81e-09	138	269	124	279	Crystalstructure of immunomodulatory active chitinase from Trichuris suis, TsES1 [Trichuris suis],6G9C_B Crystal structure of immunomodulatory active chitinase from Trichuris suis, TsES1 [Trichuris suis],6G9E_A Crystal structure of immunomodulatory active chitinase from Trichuris suis - TsES1 - 6 molecules in ASU [Trichuris suis],6G9E_B Crystal structure of immunomodulatory active chitinase from Trichuris suis - TsES1 - 6 molecules in ASU [Trichuris suis],6G9E_C Crystal structure of immunomodulatory active chitinase from Trichuris suis - TsES1 - 6 molecules in ASU [Trichuris suis],6G9E_D Crystal structure of immunomodulatory active chitinase from Trichuris suis - TsES1 - 6 molecules in ASU [Trichuris suis],6G9E_E Crystal structure of immunomodulatory active chitinase from Trichuris suis - TsES1 - 6 molecules in ASU [Trichuris suis],6G9E_F Crystal structure of immunomodulatory active chitinase from Trichuris suis - TsES1 - 6 molecules in ASU [Trichuris suis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O32258	6.02e-19	93	357	60	343	Uncharacterized glycosylase YvbX OS=Bacillus subtilis (strain 168) OX=224308 GN=yvbX PE=3 SV=1
O05495	3.97e-14	88	342	126	400	Putative sporulation-specific glycosylase YdhD OS=Bacillus subtilis (strain 168) OX=224308 GN=ydhD PE=1 SV=2
O31682	1.29e-12	142	269	81	212	Putative glycosylase YkvQ OS=Bacillus subtilis (strain 168) OX=224308 GN=ykvQ PE=3 SV=1
P37531	2.52e-11	87	343	131	409	Cortical fragment-lytic enzyme OS=Bacillus subtilis (strain 168) OX=224308 GN=sleL PE=1 SV=2
Q4JK71	8.49e-09	115	346	94	356	Chitinase-like mite allergen Der p 18.0101 OS=Dermatophagoides pteronyssinus OX=6956 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.001072	0.139297	0.859124	0.000141	0.000216	0.000123

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003570_01274.