CAZyme Information: MGYG000003570_02122

Basic Information

• Species: Treponema_D sp900769985
• Lineage: Bacteria; Spirochaetota; Spirochaetia; Treponematales; Treponemataceae; Treponema_D; Treponema_D sp900769985
• CAZyme ID: MGYG000003570_02122
• CAZy Family: CBM50
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
282		30405.95	9.9151

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003570	3193382	MAG	Fiji	Oceania

• Gene Location: Start: 116388; End: 117236 Strand: -

Full Sequence      

MFDFLKKIFLSFFIAISGVTVFAESVHLVKKGETLYSIGRKYQITVSELRAANNLSESDV
LKAGQKLIIPNADIENAATLSSNSTKTVSSEKTESYVVQKGDTLYGIAKKYDIKVAELYS
LNGLNSNDVLKAGQKLKVPVSSGAESLPDLTDLDPRKYTSKSTDPNLTWPVKNPAVTYVK
GKVSGVQLTSASKENVVNIHSGTVMFTGSYRGFGEVVFVQSKTGLVYAYTGLSSVKVKKG
AYVVYGDILGKAGVDAMSKKNGIMLMVIQNGEYIDPAKAPRG

Enzyme Prediction     

No EC number prediction in MGYG000003570_02122.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CBM50	96	139	5.7e-16	0.975

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG0739	NlpD	2.78e-19	25	278	2	259	Murein DD-endopeptidase MepM and murein hydrolase activator NlpD, contain LysM domain [Cell wall/membrane/envelope biogenesis].
PRK06347	PRK06347	1.35e-16	26	142	407	527	1,4-beta-N-acetylmuramoylhydrolase.
PRK06347	PRK06347	2.84e-16	26	201	332	506	1,4-beta-N-acetylmuramoylhydrolase.
cd00118	LysM	5.03e-16	95	138	2	45	Lysin Motif is a small domain involved in binding peptidoglycan. LysM, a small globular domain with approximately 40 amino acids, is a widespread protein module involved in binding peptidoglycan in bacteria and chitin in eukaryotes. The domain was originally identified in enzymes that degrade bacterial cell walls, but proteins involved in many other biological functions also contain this domain. It has been reported that the LysM domain functions as a signal for specific plant-bacteria recognition in bacterial pathogenesis. Many of these enzymes are modular and are composed of catalytic units linked to one or several repeats of LysM domains. LysM domains are found in bacteria and eukaryotes.
PRK06347	PRK06347	7.57e-16	26	138	481	591	1,4-beta-N-acetylmuramoylhydrolase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QTQ15942.1	1.29e-96	9	282	24	327
QTQ12082.1	1.82e-96	21	282	29	327
QTQ13716.1	5.95e-95	21	282	29	327
AEB14937.1	1.45e-91	27	282	29	288
AEE17018.1	2.07e-90	13	282	11	284

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4B8V_A	1.31e-08	27	145	44	167	ChainA, Extracellular Protein 6 [Fulvia fulva],4B9H_A Chain A, Extracellular Protein 6 [Fulvia fulva]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O31852	4.46e-14	29	144	31	137	D-gamma-glutamyl-meso-diaminopimelic acid endopeptidase CwlS OS=Bacillus subtilis (strain 168) OX=224308 GN=cwlS PE=1 SV=1
Q6GJK9	1.17e-12	15	162	17	155	N-acetylmuramoyl-L-alanine amidase sle1 OS=Staphylococcus aureus (strain MRSA252) OX=282458 GN=sle1 PE=3 SV=1
P54421	2.15e-12	6	142	3	133	Probable peptidoglycan endopeptidase LytE OS=Bacillus subtilis (strain 168) OX=224308 GN=lytE PE=1 SV=1
O07532	6.15e-12	29	138	31	135	Peptidoglycan endopeptidase LytF OS=Bacillus subtilis (strain 168) OX=224308 GN=lytF PE=1 SV=2
Q49UX4	6.94e-12	15	146	17	134	N-acetylmuramoyl-L-alanine amidase sle1 OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41) OX=342451 GN=sle1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000732	0.998470	0.000251	0.000178	0.000181	0.000173

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003570_02122.