CAZyme Information: MGYG000003572_00538

Basic Information

• Species: Prevotella sp900770025
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella sp900770025
• CAZyme ID: MGYG000003572_00538
• CAZy Family: GH127
• CAZyme Description: Non-reducing end beta-L-arabinofuranosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
704		79172.14	7.9698

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003572	2050564	MAG	Fiji	Oceania

• Gene Location: Start: 10331; End: 12445 Strand: -

Full Sequence      

MRTFNKKAQSLAALSAVAAMLCSVPCQAQHEGMTYTHNSKHAVMDATPITDVKWDKGFWG
ERFKVFGGTSVQSMWETWKSDKGHSYNNFLIAAGEKQGKRHGPPFHDGDFYKWLEAVVSV
YAVTHDAQLEKIADEVIRLIAKSQRPDGYLHTPVIIAEMNRKALQDEAKENEVIGTKVGS
GKDGAFGNRLNFETYNLGHLITAGIIHKRATGKTTLFDCAVKAADFLCSFYENNADELAR
NAICPSHYMAMVEIYRATGNPRYLTTAQGMIDIRGKVENGTDDNQDRIPFRQQYQAMGHS
VRANYLYAGVADLYIESGEEQLMKNLTSIWDDIVNRKMYINGACGALYDGTSPDGTDYKP
DNVQKVHQSYGRPYQLPHSTAHNETCANIGNMLLNWRMLLATGEEKYAGLVENCFYNSIL
CGISLDGKKYFYTNPLRMSNELPYKLRWPKERTEYISCFCCPPNTLRTLCQAQNYAYSIG
RNNSIYINMYGANTMKTQIEGLGTVGIRQETDYPWDGTVKLTITQMKGNKEFDLKLRIPE
WAAGAKVSITQKKGIKQEITAPKAGKYLTLTQTWSKGDVITLTLPMETRVIEANPLVEEC
RGQVAVQRGPILYCLESNDLNGMDIDNIAIPVNATFTPVETTIEGSRMMALETEAVDRSE
KTWTGTLYRTANTEKKKVKVRLIPYYAWGNRGKSEMTVWMPAVY

Enzyme Prediction     

EC	3.2.1.-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH127	52	614	4.7e-181	0.9980916030534351

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07944	Glyco_hydro_127	0.0	51	614	1	503	Beta-L-arabinofuranosidase, GH127. One member of this family, from Bidobacterium longicum, UniProtKB:E8MGH8, has been characterized as an unusual beta-L-arabinofuranosidase enzyme, EC:3.2.1.185. It rleases l-arabinose from the l-arabinofuranose (Araf)-beta1,2-Araf disaccharide and also transglycosylates 1-alkanols with retention of the anomeric configuration. Terminal beta-l-arabinofuranosyl residues have been found in arabinogalactan proteins from a mumber of different plantt species. beta-l-Arabinofuranosyl linkages with 1-4 arabinofuranosides are also found in the sugar chains of extensin and solanaceous lectins, hydroxyproline (Hyp)2-rich glycoproteins that are widely observed in plant cell wall fractions. The critical residue for catalytic activity is Glu-338, in a ET/SCAS sequence context.
COG3533	COG3533	1.51e-132	57	702	21	587	Uncharacterized conserved protein, DUF1680 family [Function unknown].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT38421.1	7.25e-318	28	701	20	695
QUR43102.1	1.45e-317	28	701	20	695
QRN01927.1	1.45e-317	28	701	20	695
BCA50085.1	2.18e-317	28	701	20	695
QUT70969.1	2.87e-317	28	702	20	696

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5MQO_A	1.40e-317	28	701	20	695	Glycosidehydrolase BT_1003 [Bacteroides thetaiotaomicron]
4QJY_A	1.27e-120	50	700	14	645	Crystalstructure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QJY_B Crystal structure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
6EX6_A	1.78e-116	44	701	7	624	TheGH127, Beta-arabinofuranosidase, BT3674 [Bacteroides thetaiotaomicron VPI-5482],6EX6_B The GH127, Beta-arabinofuranosidase, BT3674 [Bacteroides thetaiotaomicron VPI-5482]
4QK0_A	9.75e-116	50	700	14	645	Crystalstructure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_B Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_C Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_D Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
7EXU_A	1.04e-75	82	698	50	654	ChainA, Non-reducing end beta-L-arabinofuranosidase [Bifidobacterium longum subsp. longum JCM 1217]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
E8MGH8	1.22e-74	82	698	50	654	Non-reducing end beta-L-arabinofuranosidase OS=Bifidobacterium longum subsp. longum (strain ATCC 15707 / DSM 20219 / JCM 1217 / NCTC 11818 / E194b) OX=565042 GN=hypBA1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000881	0.651816	0.345955	0.000841	0.000277	0.000213

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003572_00538.